3TQ7: EB1c/EB3c heterodimer

EB1c/EB3c heterodimer in complex with the CAP-Gly domain of P150glued. Determined by X-ray diffraction at 2.3 Å resolution. Released 25 Jan 2012.

Method: X-ray diffraction
Resolution: 2.3 Å
Organism: Homo sapiens
Chains: 4
Atoms: 2,057
Mol. weight: 34.15 kDa
Released: 25 Jan 2012

Explore 3TQ7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3TQ7 contains 6 α-helices and 17 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	202-229	28
α-helix	238-246	9

Chain B: 2 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	206-238	33
α-helix	247-255	9
β-strand	280	1	1

Chains P and Q: 1 helix, 8 β-strands

Element	Residues	Length	Sheet
β-strand	32-35	4	1
β-strand	41-48	8	1
β-strand	57-62	6	1
β-strand	69	1	1
β-strand	72-73	2	2
β-strand	76-77	2	2
β-strand	86-89	4	1
α-helix	91-93	3
β-strand	94-96	3	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Microtubule-associated protein RP/EB family member 1	A	protein	78	Homo sapiens	Q15691 (AlphaFold model)
Microtubule-associated protein RP/EB family member 3	B	protein	82	Homo sapiens	Q9UPY8 (AlphaFold model)
Dynactin subunit 1	P, Q	protein	71	Homo sapiens	Q14203 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3TQ7_1 Microtubule-associated protein RP/EB family member 1 (chains A)
DEAAELMQQVNVLKLTVEDLEKERDFYFGKLRNIELICQENEGENDPVLQRIVDILYATD
EGFVIPDEGGPQEEQEEY

Sequence of entity 2 (B), FASTA

>3TQ7_2 Microtubule-associated protein RP/EB family member 3 (chains B)
AQILELNQQLVDLKLTVDGLEKERDFYFSKLRDIELICQEHESENSPVISGIIGILYATE
EGFAPPEDDEIEEHQQEDQDEY

Sequence of entity 3 (P, Q), FASTA

>3TQ7_3 Dynactin subunit 1 (chains P, Q)
LRVGSRVEVIGKGHRGTVAYVGMTLFATGKWVGVILDEAKGKNDGTVQGRKYFTCDEGHG
IFVRQSQIQVF

Primary citation

Interaction of mammalian end binding proteins with CAP-Gly domains of CLIP-170 and p150(glued). Bjelic, S., De Groot, C.O., Scharer, M.A. et al. J Struct Biol (2012) 177:160-167. DOI 10.1016/j.jsb.2011.11.010 · PubMed

Other PDB entries of the same protein (UniProt Q15691 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2QJZ 1.25 Å, Structural Basis of Microtubule Plus End Tracking by XMAP215, CLIP-170 and EB1
2R8U 1.35 Å, Structure of fragment of human end-binding protein 1 (EB1) containing the N-terminal…
1PA7 1.45 Å, Crystal structure of amino-terminal microtubule binding domain of EB1
1WU9 1.54 Å, Crystal structure of the C-terminal domain of the end-binding protein 1 (EB1)
5JVM 1.57 Å, The neck-linker and alpha 7 helix of Mus musculus KIF3C
1VKA 1.6 Å, Southeast Collaboratory for Structural Genomics: Hypothetical Human Protein Q15691…
5JX1 1.67 Å, The neck-linker and alpha 7 helix of Mus musculus KIF3A fused to EB1
1TXQ 1.8 Å, Crystal structure of the EB1 C-terminal domain complexed with the CAP-Gly domain of…
1YIB 1.8 Å, Crystal Structure of the Human EB1 C-terminal Dimerization Domain
6YF5 1.83 Å, Lamin A 17-70 coil1A dimer stabilized by C-terminal capping
2HKQ 1.86 Å, Crystal structure of the C-terminal domain of human EB1 in complex with the CAP-Gly…
2HL5 1.93 Å, Crystal structure of the C-terminal domain of human EB1 in complex with the A49M mutant…

Browse structure collections

About this viewer

MolViewer shows 3TQ7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.