3UAT: Disks large homolog 1

Guanylate Kinase Domains of the MAGUK Family Scaffold Proteins as Specific Phospho-Protein Binding Modules. Determined by X-ray diffraction at 2.7 Å resolution. Released 7 Dec 2011.

Method: X-ray diffraction
Resolution: 2.7 Å
Organism: Rattus norvegicus
Chains: 2
Atoms: 2,330
Mol. weight: 36.55 kDa
Released: 7 Dec 2011

Explore 3UAT in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3UAT contains 12 α-helices and 20 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	583-587	5	1
β-strand	603	1	1
β-strand	611-616	6	1
β-strand	622-628	7	1
β-strand	633	1	1
β-strand	638-641	4	1
α-helix	643-651	9
β-strand	710-712	3	1
β-strand	713-717	5	2
α-helix	721-723	3
β-strand	724-727	4	3
α-helix	731-741	11
β-strand	746-747	2	4
β-strand	752-753	2	5
α-helix	756-758	3
β-strand	768-769	2	5
α-helix	773-781	9
β-strand	785-791	7	5
β-strand	794-799	6	5
α-helix	800-807	8
β-strand	812-813	2	4
β-strand	814-815	2	3
α-helix	820-827	8
β-strand	833-837	5	3
α-helix	842-848	7
α-helix	854-871	18
α-helix	872-874	3
β-strand	877-879	3	3
α-helix	884-898	15
β-strand	902-906	5	2

Chain B: 1 helix, 1 β-strand

Element	Residues	Length	Sheet
α-helix	0-3	4
β-strand	6-7	2	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Disks large homolog 1	A	protein	296	Rattus norvegicus	Q62696 (AlphaFold model)
phosphor-LGN peptide	B	protein	18	Rattus norvegicus	D3ZCE5 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3UAT_1 Disks large homolog 1 (chains A)
GPGSEFSQKRSLYVRALFDYDKTKDSGLPSQGLNFKFGDILHVINASDDEWWQARQVTPD
GESDEVGVIPSKRRVEKKERARLKTVKFNSKVLSYEPVNQQEVNYTRPVIILGPMKDRVN
DDLISEFPDKFGSCVPHTTRPKRDYEVDGRDYHFVTSREQMEKDIQEHKFIEAGQYNNHL
YGTSVQSVRAVAEKGKHCILDVSGNAIKRLQIAQLYPISIFIKPKSMENIMEMNKRLTDE
QARKTFERAVRLEQEFTEHFTAIVQGDTLEDIYNQVKQIIEEQSGPYIWVPAKEKL

Sequence of entity 2 (B), FASTA

>3UAT_2 phosphor-LGN peptide (chains B)
GRRHSMENLELMKLTPEK

Primary citation

Guanylate kinase domains of the MAGUK family scaffold proteins as specific phospho-protein-binding modules. Zhu, J., Shang, Y., Xia, C. et al. EMBO J (2011). DOI 10.1038/emboj.2011.428 · PubMed

Other PDB entries of the same protein (UniProt Q62696 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2AWX 1.8 Å, Synapse associated protein 97 PDZ2 domain variant C378S
2AWW 2.21 Å, Synapse associated protein 97 PDZ2 domain variant C378G with C-terminal GluR-A peptide
2I0L 2.31 Å, X-ray crystal structure of Sap97 PDZ2 bound to the C-terminal peptide of HPV18 E6.
2G2L 2.35 Å, Crystal Structure of the Second PDZ Domain of SAP97 in Complex with a GluR-A C-terminal…
2AWU 2.44 Å, Synapse associated protein 97 PDZ2 domain variant C378G
2I0I 2.8 Å, X-ray crystal structure of Sap97 PDZ3 bound to the C-terminal peptide of HPV18 E6
1RSO Hetero-tetrameric L27 (Lin-2, Lin-7) domain complexes as organization platforms of…
1ZOK PDZ1 Domain Of Synapse Associated Protein 97

Browse structure collections

About this viewer

MolViewer shows 3UAT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.