3UM7: Human two pore domain K+ ion channel TRAAK

Crystal structure of the human two pore domain K+ ion channel TRAAK (K2P4.1). Determined by X-ray diffraction at 3.31 Å resolution. Released 8 Feb 2012.

Method: X-ray diffraction
Resolution: 3.31 Å
Organism: Homo sapiens
Chains: 2
Atoms: 3,745
Mol. weight: 67.37 kDa
Released: 8 Feb 2012

Explore 3UM7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3UM7 contains 25 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 0 β-strands

Element	Residues	Length
α-helix	29-54	26
α-helix	61-69	9
α-helix	70-72	3
α-helix	82-96	15
α-helix	116-127	12
α-helix	140-175	36
α-helix	177-183	7
α-helix	192-206	15
α-helix	207-211	5
α-helix	212-221	10
α-helix	225-236	12
α-helix	257-282	26

Chain B: 13 helices, 0 β-strands

Element	Residues	Length
α-helix	32-54	23
α-helix	56-73	18
α-helix	84-96	13
α-helix	116-127	12
α-helix	140-151	12
α-helix	154-167	14
α-helix	170-172	3
α-helix	173-176	4
α-helix	196-205	10
α-helix	206-210	5
α-helix	211-221	11
α-helix	225-236	12
α-helix	258-282	25

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Potassium channel subfamily K member 4	A, B	protein	309	Homo sapiens	Q9NYG8 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3UM7_1 Potassium channel subfamily K member 4 (chains A, B)
MTTAPQEPPARPLQAGSGAGPAPGRAMRSTTLLALLALVLLYLVSGALVFRALEQPHEQQ
AQRELGEVREKFLRAHPCVSDQELGLLIKEVADALGGGADPETQSTSQSSHSAWDLGSAF
FFSGTIITTIGYGNVALRTDAGRLFCIFYALVGIPLFGILLAGVGDRLGSSLRHGIGHIE
AIFLKWHVPPELVRVLSAMLFLLIGCLLFVLTPTFVFCYMEDWSKLEAIYFVIVTLTTVG
FGDYVAGADPRQDSPAYQPLVWFWILLGLAYFASVLTTIGNWLRVVSRRTRAEMGGLTAQ
SNSLEVLFQ

Primary citation

Crystal structure of the human K2P TRAAK, a lipid- and mechano-sensitive K+ ion channel. Brohawn, S.G., del Marmol, J., MacKinnon, R. Science (2012) 335:436-441. DOI 10.1126/science.1213808 · PubMed

Other PDB entries of the same protein (UniProt Q9NYG8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7LJ5 2.26 Å, Human TRAAK K+ channel FHIEG mutant A198E in a K+ bound conductive conformation
4WFE 2.5 Å, Human TRAAK K+ channel in a K+ bound conductive conformation
4WFF 2.5 Å, Human TRAAK K+ channel in a K+ bound nonconductive conformation
4I9W 2.75 Å, Human two pore domain K+ channel TRAAK (K2P4.1) - Fab complex structure
7LJA 2.77 Å, Human TRAAK K+ channel FHEIG mutant A198E in a Tl+ bound conductive conformation
7LJ4 2.78 Å, Human TRAAK K+ channel FHEIG mutant A270P in a K+ bound conductive conformation
7LJB 2.97 Å, Human TRAAK K+ channel mutant G158D in a K+ bound conductive conformation
4WFG 3.0 Å, Human TRAAK K+ channel in a Tl+ bound conductive conformation
4WFH 3.01 Å, Human TRAAK K+ channel in a Tl+ bound nonconductive conformation
4RUE 3.3 Å, Human K2P4.1 (TRAAK) potassium channel, G124I mutant
4RUF 3.4 Å, Human K2P4.1 (TRAAAK) potassium channel, W262S mutant

Browse structure collections

About this viewer

MolViewer shows 3UM7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.