3UNN: Monomeric structure of the human MDC1 FHA domain

Monomeric structure of the human MDC1 FHA domain in complex with an MDC1 phospho-T4 peptide. Determined by X-ray diffraction at 1.7 Å resolution. Released 25 Jan 2012.

Method: X-ray diffraction
Resolution: 1.7 Å
Organism: Homo sapiens
Chains: 2
Atoms: 981
Mol. weight: 13.51 kDa
Released: 25 Jan 2012

Explore 3UNN in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3UNN contains 3 α-helices and 13 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	32-36	5	1
β-strand	39	1	2
β-strand	42	1	2
β-strand	45-49	5	1
β-strand	52-57	6	3
β-strand	64-65	2	3
β-strand	76-80	5	3
β-strand	88-91	4	3
β-strand	98-100	3	1
β-strand	105-106	2	1
α-helix	107-108	2
β-strand	113-114	2	3
α-helix	115-116	2
β-strand	120-123	4	1
β-strand	126-132	7	1

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	2-7	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Mediator of DNA damage checkpoint protein 1	A	protein	113	Homo sapiens	Q14676 (AlphaFold model)
phospho-T4 peptide from Mediator of DNA damage checkpoint protein 1	B	protein	8	Homo sapiens	Q14676 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3UNN_1 Mediator of DNA damage checkpoint protein 1 (chains A)
SNVEPVGRLHIFSGAHGPEKDFPLHLGKNVVGRMPDCSVALPFPSISKQHAEIEILAWDK
APILRDCGSLNGTQILRPPKVLSPGVSHRLRDQELILFADLLCQYHRLDVSLP

Sequence of entity 2 (B), FASTA

>3UNN_2 phospho-T4 peptide from Mediator of DNA damage checkpoint protein 1 (chains B)
MEDTQAID

Primary citation

Structural mechanism of the phosphorylation-dependent dimerization of the MDC1 forkhead-associated domain. Liu, J., Luo, S., Zhao, H. et al. Nucleic Acids Res (2012) 40:3898-3912. DOI 10.1093/nar/gkr1296 · PubMed

Other PDB entries of the same protein (UniProt Q14676 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2ETX 1.33 Å, Crystal Structure of MDC1 Tandem BRCT Domains
3K05 1.33 Å, The crystal structure of MDC1 BRCT T2067D in complex with a minimal recognition…
2ADO 1.45 Å, Crystal Structure Of The Brct Repeat Region From The Mediator of DNA damage checkpoint…
3UMZ 1.65 Å, Crystal Structure of the human MDC1 FHA Domain
3UNM 1.8 Å, Crystal Structure of The Human MDC1 FHA Domain
3UOT 1.8 Å, Crystal Structure of MDC1 FHA Domain in Complex with a Phosphorylated Peptide from the…
3UN0 2.3 Å, Crystal Structure of MDC1 FHA Domain
9QJZ 2.31 Å, Crystal structure of ARC4 from human Tankyrase 2 in complex with phosphorylated peptide…
2AZM 2.41 Å, Crystal structure of the MDC1 brct repeat in complex with the histone tail of gamma-H2AX
9IF9 2.55 Å, Crystal structure of the Pellino 1 FHA domain in complex with a MDC1-TQxF phosphopeptide.
3UEO 2.6 Å, Crystal structure of TopBP1 BRCT4/5 domains in complex with a phospho-peptide

Browse structure collections

About this viewer

MolViewer shows 3UNN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.