3UPF: Murine norovirus RNA-dependent RNA polymerase

Crystal structure of murine norovirus RNA-dependent RNA polymerase bound to NF023. Determined by X-ray diffraction at 2.6 Å resolution. Released 2 May 2012.

Method

X-ray diffraction

Resolution

2.6 Å

Organism

Murine norovirus 1

Chains

3

Atoms

12,242

Mol. weight

182.37 kDa

Ligands

0BU

Released

2 May 2012

Explore 3UPF in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3UPF contains 81 α-helices and 78 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 26 helices, 28 β-strands

Molecules and chains

>3UPF_1 RNA-dependent RNA polymerase (chains A, B, C)
MKALEFQGPPMLPRPSGTYAGLPIADYGDAPPLSTKTMFWRTSPEKLPPGAWEPAYLGSK
DERVDGPSLQQVMRDQLKPYSEPRGLLPPQEILDAVCDAIENRLENTLEPQKPWTFKKAC
ESLDKNTSSGYPYHKQKSKDWTGSAFIGDLGDQATHANNMYEMGKSMRPIYTAALKDELV
KPDKIYGKIKKRLLWGSDLGTMIRAARAFGPFCDALKETCIFNPIRVGMSMNEDGPFIFA
RHANFRYHMDADYTRWDSTQQRAILKRAGDIMVRLSPEPDLARVVMDDLLAPSLLDVGDY
KIVVEEGLPSGCPCTTQLNSLAHWILTLCAMVEVTRVDPDIVMQESEFSFYGDDEVVSTN
LELDMVKYTMALRRYGLLPTRADKEEGPLERRQTLQGISFLRRAIVGDQFGWYGRLDRAS
IDRQLLWTKGPNHQNPFETLPGHAQRPSQLMALLGEAAMHGEKYYRTVASRVSKEAAQSG
IEMVVPRHRSVLRWVRFGTMDAETPQERSAVFVNEDELEHHHHHH

Ligands and cofactors

Water and common crystallization additives (SO4) are not listed.

Primary citation

Structure-Based Inhibition of Norovirus RNA-Dependent RNA Polymerases. Mastrangelo, E., Pezzullo, M., Tarantino, D. et al. J Mol Biol (2012) 419:198-210. DOI 10.1016/j.jmb.2012.03.008 · PubMed

Related structures

Other PDB entries of the same protein (UniProt Q80J95 (AlphaFold model), which also has an AlphaFold model), best resolution first:

• 4ASH 1.58 Å, Crystal structure of the NS6 protease from murine norovirus 1
• 3UQS 2.0 Å, Crystal structures of murine norovirus RNA-dependent RNA polymerase
• 3SFG 2.21 Å, crystal structure of murine norovirus RNA dependent RNA polymerase in complex with…
• 4NRU 2.3 Å, Murine Norovirus RNA-dependent-RNA-polymerase in complex with Compound 6, a suramin…
• 4X2V 2.3 Å, Crystal structure of the Murine Norovirus NS6 protease (inactive C139A mutant) with a…
• 8A8X 2.37 Å, TRIM7 PRYSPRY in complex with a MNV1-NS3 peptide HDDFGLQ
• 4O4R 2.4 Å, Murine Norovirus RdRp in complex with PPNDS
• 4X2Y 2.42 Å, Crystal structure of a chimeric Murine Norovirus NS6 protease (inactive C139A mutant) in…
• 3UR0 2.45 Å, Crystal structures of murine norovirus RNA-dependent RNA polymerase in complex with…
• 4X2X 2.47 Å, Crystal structure of the Murine Norovirus NS6 protease (inactive C139A mutant) with a…
• 3QID 2.5 Å, Crystal structures and functional analysis of murine norovirus RNA-dependent RNA…
• 3SFU 2.5 Å, crystal structure of murine norovirus RNA dependent RNA polymerase in complex with…

Browse structure collections

About this viewer

MolViewer shows 3UPF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.