3UR0: Murine norovirus RNA-dependent RNA polymerase

Crystal structures of murine norovirus RNA-dependent RNA polymerase in complex with Suramin. Determined by X-ray diffraction at 2.45 Å resolution. Released 2 May 2012.

Method

X-ray diffraction

Resolution

2.45 Å

Organism

murine norovirus

Chains

3

Atoms

12,050

Mol. weight

179.87 kDa

Ligands

SVR

Released

2 May 2012

Explore 3UR0 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3UR0 contains 82 α-helices and 80 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 26 helices, 28 β-strands

Molecules and chains

>3UR0_1 RNA-dependent RNA polymerase (chains A, B, C)
MLPRPSGTYAGLPIADYGDAPPLSTKTMFWRTSPEKLPPGAWEPAYLGSKDERVDGPSLQ
QVMRDQLKPYSEPRGLLPPQEILDAVCDAIENRLENTLEPQKPWTFKKACESLDKNTSSG
YPYHKQKSKDWTGSAFIGDLGDQATHANNMYEMGKSMRPIYTAALKDELVKPDKIYGKIK
KRLLWGSDLGTMIRAARAFGPFCDALKETCIFNPIRVGMSMNEDGPFIFARHANFRYHMD
ADYTRWDSTQQRAILKRAGDIMVRLSPEPDLARVVMDDLLAPSLLDVGDYKIVVEEGLPS
GCPCTTQLNSLAHWILTLCAMVEVTRVDPDIVMQESEFSFYGDDEVVSTNLELDMVKYTM
ALRRYGLLPTRADKEEGPLERRQTLQGISFLRRAIVGDQFGWYGRLDRASIDRQLLWTKG
PNHQNPFETLPGHAQRPSQLMALLGEAAMHGEKYYRTVASRVSKEAAQSGIEMVVPRHRS
VLRWVRFGTMDAETPQERSAVFVNEDELEHHHHHH

Ligands and cofactors

Water and common crystallization additives (SO4) are not listed.

Primary citation

Structure-Based Inhibition of Norovirus RNA-Dependent RNA Polymerases. Mastrangelo, E., Pezzullo, M., Tarantino, D. et al. J Mol Biol (2012) 419:198-210. DOI 10.1016/j.jmb.2012.03.008 · PubMed

Related structures

Other PDB entries of the same protein (UniProt Q80J95 (AlphaFold model), which also has an AlphaFold model), best resolution first:

• 4ASH 1.58 Å, Crystal structure of the NS6 protease from murine norovirus 1
• 3UQS 2.0 Å, Crystal structures of murine norovirus RNA-dependent RNA polymerase
• 3SFG 2.21 Å, crystal structure of murine norovirus RNA dependent RNA polymerase in complex with…
• 4NRU 2.3 Å, Murine Norovirus RNA-dependent-RNA-polymerase in complex with Compound 6, a suramin…
• 4X2V 2.3 Å, Crystal structure of the Murine Norovirus NS6 protease (inactive C139A mutant) with a…
• 8A8X 2.37 Å, TRIM7 PRYSPRY in complex with a MNV1-NS3 peptide HDDFGLQ
• 4O4R 2.4 Å, Murine Norovirus RdRp in complex with PPNDS
• 4X2Y 2.42 Å, Crystal structure of a chimeric Murine Norovirus NS6 protease (inactive C139A mutant) in…
• 4X2X 2.47 Å, Crystal structure of the Murine Norovirus NS6 protease (inactive C139A mutant) with a…
• 3QID 2.5 Å, Crystal structures and functional analysis of murine norovirus RNA-dependent RNA…
• 3SFU 2.5 Å, crystal structure of murine norovirus RNA dependent RNA polymerase in complex with…
• 3NAI 2.56 Å, Crystal structures and functional analysis of murine norovirus RNA-dependent RNA…

Browse structure collections

About this viewer

MolViewer shows 3UR0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.