3V4Q: R335W mutant of human Lamin

Structure of R335W mutant of human Lamin. Determined by X-ray diffraction at 3.06 Å resolution. Released 29 Feb 2012.

Method: X-ray diffraction
Resolution: 3.06 Å
Organism: Homo sapiens
Chains: 1
Atoms: 622
Mol. weight: 8.93 kDa
Released: 29 Feb 2012

Explore 3V4Q in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3V4Q contains 1 α-helix and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	316-384	69

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Prelamin-A/C	A	protein	74	Homo sapiens	P02545 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3V4Q_1 Prelamin-A/C (chains A)
LAAKEAKLRDLEDSLARERDTSWRLLAEKEREMAEMRARMQQQLDEYQELLDIKLALDME
IHAYRKLLEGEEER

Primary citation

Structures of the lamin A/C R335W and E347K mutants: Implications for dilated cardiolaminopathies. Bollati, M., Barbiroli, A., Favalli, V. et al. Biochem Biophys Res Commun (2012) 418:217-221. DOI 10.1016/j.bbrc.2011.12.136 · PubMed

Other PDB entries of the same protein (UniProt P02545 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7WZZ 1.3 Å, Crystal structure of peptide KAGQVVTIW in complex with HLA-B5801
7X1B 1.4 Å, Crystal structure of peptide KAGQVVTI in complex with HLA-B5801
1IFR 1.4 Å, Structure of Lamin A/C Globular Domain
3GEF 1.5 Å, Crystal structure of the R482W mutant of lamin A/C
8I33 1.62 Å, Coil 1a of lamin A (residue 25-65)
7Z21 1.63 Å, BAF A12T bound to the lamin A/C Ig-fold domain
7CRG 1.8 Å, Beta-strand-mediated dimeric formation of the extended Ig-like domains of human lamin A/C
7X5D 1.82 Å, Crystal Structure of the K316C mutant of Human Lamin A/C Coil 2 (residues 244-340)
6YF5 1.83 Å, Lamin A 17-70 coil1A dimer stabilized by C-terminal capping
6GHD 2.1 Å, Structural analysis of the ternary complex between lamin A/C, BAF and emerin identifies…
7YVD 2.1 Å, The crystal structure of the progerin C-terminal peptide and the Ig-like domain of lamin…
1X8Y 2.2 Å, Human lamin coil 2B

Browse structure collections

About this viewer

MolViewer shows 3V4Q directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.