3VLC: S. cerevisiae Get3 in the semi open conformation

Crystal structure of S. cerevisiae Get3 in the semi open conformation in complex with Get1 cytosolic domain at 4.5 angstrom resolution. Determined by X-ray diffraction at 4.5 Å resolution. Released 20 Jun 2012.

Method: X-ray diffraction
Resolution: 4.5 Å
Organism: Saccharomyces cerevisiae
Chains: 2
Atoms: 2,950
Mol. weight: 51.13 kDa
Ligands: ADP
Released: 20 Jun 2012

Explore 3VLC in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3VLC contains 20 α-helices and 10 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 16 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	10-14	5
β-strand	20-24	5	1
α-helix	31-44	14
β-strand	51-55	5	1
α-helix	61-66	6
β-strand	75-76	2	1
β-strand	78	1	2
β-strand	80	1	2
β-strand	83-87	5	1
α-helix	90-93	4
α-helix	128-132	5
α-helix	136-155	20
β-strand	162-166	5	1
α-helix	176-178	3
α-helix	179-184	6
α-helix	219-230	12
β-strand	236-243	8	1
α-helix	246-262	17
β-strand	266-274	9	1
α-helix	277-279	3
α-helix	290-305	16
β-strand	310-315	6	1
α-helix	323-331	9
α-helix	332-334	3
α-helix	342-344	3
α-helix	346-348	3

Chain E: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	40-56	17
α-helix	65-81	17
α-helix	85-88	4
α-helix	93-96	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
ATPase GET3	A	protein	354	Saccharomyces cerevisiae	Q12154 (AlphaFold model)
Golgi to ER traffic protein 1	E	protein	94	Saccharomyces cerevisiae	P53192 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3VLC_1 ATPase GET3 (chains A)
MDLTVEPNLHSLITSTTHKWIFVGGKGGVGKTTSSCSIAIQMALSQPNKQFLLISTDPAH
NLSDAFGEKFGKDARKVTGMNNLSCMEIDPSAALKDMNDMAVSRANNNGSDGQGDDLGSL
LQGGALADLTGSIPGIDEALSFMEVMKHIKRQEQDEGETFDTVIFDTAPTGHTLRFLQLP
NTLSKLLEKFGEITNKLGPMLNSFMGAGNVDISGKLNELKANVETIRQQFTDPDLTTFVC
VCISEFLSLYETERLIQELISYDMDVNSIIVNQLLFAENDQEHNCKRCQARWKMQKKYLD
QIDELYEDFHVVKMPLCAGEIRGLNNLTKFSQFLNKEYNPITDGKVIYELEDKE

Sequence of entity 2 (E), FASTA

>3VLC_2 Golgi to ER traffic protein 1 (chains E)
MGSSHHHHHHTNKYHEKWISKFAPGNELSKKYLAKVKERHELKEFNNSISAQDNYAKWTK
NNRKLDSLDKEINNLKDEIQSENKAFQAHLHKLR

Ligands and cofactors

ID	Name	Formula	Copies
ADP	Adenosine-5'-diphosphate	C10 H15 N5 O10 P2	1

Primary citation

Get1 stabilizes an open dimer conformation of get3 ATPase by binding two distinct interfaces. Kubota, K., Yamagata, A., Sato, Y. et al. J Mol Biol (2012) 422:366-375. DOI 10.1016/j.jmb.2012.05.045 · PubMed

Other PDB entries of the same protein (UniProt Q12154 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2WOJ 1.99 Å, ADP-AlF4 complex of S. cerevisiae GET3
4XTR 2.05 Å, Structure of Get3 bound to the transmembrane domain of Pep12
3ZS9 2.1 Å, S. cerevisiae Get3-ADP-AlF4- complex with a cytosolic Get2 fragment
3H84 2.3 Å, Crystal structure of GET3
4XVU 2.35 Å, Structure of Get3 bound to the transmembrane domain of Nyv1
4XWO 2.75 Å, Structure of Get3 bound to the transmembrane domain of Sec22
3A36 2.8 Å, Structural insight into the membrane insertion of tail-anchored proteins by Get3
5BW8 2.8 Å, 2.8 A crystal structure of a Get3-Get4-Get5 intermediate complex from S.cerevisiae
3A37 3.0 Å, Structural insight into the membrane insertion of tail-anchored proteins by Get3
3B2E 3.0 Å, Crystal structure of S. cerevisiae Get3 in the open conformation in complex with Get1…
3SJA 3.0 Å, Crystal structure of S. cerevisiae Get3 in the open state in complex with Get1 cytosolic…
3ZS8 3.0 Å, S. cerevisiae Get3 complexed with a cytosolic Get1 fragment

Browse structure collections

About this viewer

MolViewer shows 3VLC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.