3WAL: Human LC3A_2-121

Crystal structure of human LC3A_2-121. Determined by X-ray diffraction at 2.0 Å resolution. Released 25 Dec 2013.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,057
Mol. weight: 14.81 kDa
Ligands: MLT
Released: 25 Dec 2013

Explore 3WAL in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3WAL contains 5 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	11-14	4
α-helix	17-30	14
β-strand	34-41	8	1
α-helix	49-51	3
β-strand	55-59	5	1
β-strand	63	1	2
α-helix	64-75	12
β-strand	84-87	4	1
β-strand	90-91	2	1
β-strand	98	1	2
α-helix	99-106	8
β-strand	113-118	6	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Microtubule-associated proteins 1A/1B light chain 3A	A	protein	125	Homo sapiens	Q9H492 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3WAL_1 Microtubule-associated proteins 1A/1B light chain 3A (chains A)
GSPEFPSDRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPD
HVNMSELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYEQEKDEDGFLYMVYASQ
ETFGF

Ligands and cofactors

ID	Name	Formula	Copies
MLT	D-malate	C4 H6 O5	1

Primary citation

Structural basis of the autophagy-related LC3/Atg13 LIR complex: recognition and interaction mechanism. Suzuki, H., Tabata, K., Morita, E. et al. Structure (2014) 22:47-58. DOI 10.1016/j.str.2013.09.023 · PubMed

Other PDB entries of the same protein (UniProt Q9H492 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7RA0 1.36 Å, LC3A in complex with Fragment 2-10
6TBE 1.67 Å, LC3A in complex with (3R,4S,5R,6R)-5-hydroxy-6-((4-hydroxy-3-(4-hydroxy-3-isopentylbenzam…
7R9Z 1.72 Å, LC3A in complex with Fragment 2-3
7R9W 1.75 Å, LC3A in complex with Fragment 1-1
3WAN 1.77 Å, Crystal structure of Atg13 LIR-fused human LC3A_2-121
4ZDV 1.8 Å, Crystal structure of LC3 in complex with FAM134B LIR
8T36 1.85 Å, Crystal structure of K49 acetylated LC3A in complex with the LIR of TP53INP2/DOR
8T35 1.9 Å, Crystal structure of K51 acetylated LC3A in complex with the LIR of TP53INP2/DOR
8T2L 2.24 Å, Crystal structure of LC3A in complex with the LIR of NSs4
5CX3 2.3 Å, Crystal structure of FYCO1 LIR in complex with LC3A
8T4T 2.36 Å, Crystal structure of LC3A in complex with the LIR of TP53INP2/DOR
5DPR 2.5 Å, Crystal structure of PLEKHM1 LIR-fused human LC3A_2-121

Browse structure collections

About this viewer

MolViewer shows 3WAL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.