7RA0: LC3A

LC3A in complex with Fragment 2-10. Determined by X-ray diffraction at 1.36 Å resolution. Released 12 Jan 2022.

Method: X-ray diffraction
Resolution: 1.36 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,121
Mol. weight: 14.72 kDa
Ligands: 2JI
Released: 12 Jan 2022

Explore 7RA0 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7RA0 contains 6 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	7-10	4
α-helix	13-26	14
β-strand	30-37	8	1
α-helix	45-47	3
β-strand	51-55	5	1
β-strand	59	1	2
α-helix	60-71	12
β-strand	80-83	4	1
β-strand	86-87	2	1
β-strand	94	1	2
α-helix	95-102	8
α-helix	108	1
β-strand	109-114	6	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Microtubule-associated proteins 1A/1B light chain 3A	A	protein	122	Homo sapiens	Q9H492 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7RA0_1 Microtubule-associated proteins 1A/1B light chain 3A (chains A)
GSMPSDRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHV
NMSELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYEQEKDEDGFLYMVYASQET
FG

Ligands and cofactors

ID	Name	Formula	Copies
2JI	(5-ethyl-2-methyl-1H-indol-3-yl)acetic acid	C13 H15 N O2	2

Primary citation

A Multifaceted Hit-Finding Approach Reveals Novel LC3 Family Ligands. Steffek, M., Helgason, E., Popovych, N. et al. Biochemistry (2023) 62:633-644. DOI 10.1021/acs.biochem.1c00682 · PubMed

Other PDB entries of the same protein (UniProt Q9H492 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6TBE 1.67 Å, LC3A in complex with (3R,4S,5R,6R)-5-hydroxy-6-((4-hydroxy-3-(4-hydroxy-3-isopentylbenzam…
7R9Z 1.72 Å, LC3A in complex with Fragment 2-3
7R9W 1.75 Å, LC3A in complex with Fragment 1-1
3WAN 1.77 Å, Crystal structure of Atg13 LIR-fused human LC3A_2-121
4ZDV 1.8 Å, Crystal structure of LC3 in complex with FAM134B LIR
8T36 1.85 Å, Crystal structure of K49 acetylated LC3A in complex with the LIR of TP53INP2/DOR
8T35 1.9 Å, Crystal structure of K51 acetylated LC3A in complex with the LIR of TP53INP2/DOR
3WAL 2.0 Å, Crystal structure of human LC3A_2-121
8T2L 2.24 Å, Crystal structure of LC3A in complex with the LIR of NSs4
5CX3 2.3 Å, Crystal structure of FYCO1 LIR in complex with LC3A
8T4T 2.36 Å, Crystal structure of LC3A in complex with the LIR of TP53INP2/DOR
5DPR 2.5 Å, Crystal structure of PLEKHM1 LIR-fused human LC3A_2-121

Browse structure collections

About this viewer

MolViewer shows 7RA0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.