3WAN: Atg13 LIR-fused human LC3A_2-121

Crystal structure of Atg13 LIR-fused human LC3A_2-121. Determined by X-ray diffraction at 1.77 Å resolution. Released 25 Dec 2013.

Method: X-ray diffraction
Resolution: 1.77 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,359
Mol. weight: 31.63 kDa
Released: 25 Dec 2013

Explore 3WAN in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3WAN contains 13 α-helices and 12 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	11-15	5
α-helix	18-20	3
α-helix	23-26	4
α-helix	29-42	14
β-strand	46-53	8	1
β-strand	67-71	5	1
α-helix	76-86	11
β-strand	96-99	4	1
β-strand	103	1	1
α-helix	111-118	8
α-helix	124	1
β-strand	125-130	6	1

Chain B: 6 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	12-16	5
α-helix	23-26	4
α-helix	29-42	14
β-strand	46-53	8	2
α-helix	61-63	3
β-strand	67-71	5	2
β-strand	75	1	3
α-helix	76-86	11
β-strand	96-99	4	2
β-strand	102-103	2	2
β-strand	110	1	3
α-helix	111-118	8
β-strand	125-130	6	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Autophagy-related protein 13, Microtubule-associated proteins 1A/1B light chain 3A	A, B	protein	136	Homo sapiens	Q9H492 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3WAN_1 Autophagy-related protein 13, Microtubule-associated proteins 1A/1B light chain 3A (chains A, B)
GSSSGNTHDDFVMIGSPSDRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLP
VLDKTKFLVPDHVNMSELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYEQEKDE
DGFLYMVYASQETFGF

Primary citation

Structural basis of the autophagy-related LC3/Atg13 LIR complex: recognition and interaction mechanism. Suzuki, H., Tabata, K., Morita, E. et al. Structure (2014) 22:47-58. DOI 10.1016/j.str.2013.09.023 · PubMed

Other PDB entries of the same protein (UniProt Q9H492 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7RA0 1.36 Å, LC3A in complex with Fragment 2-10
6TBE 1.67 Å, LC3A in complex with (3R,4S,5R,6R)-5-hydroxy-6-((4-hydroxy-3-(4-hydroxy-3-isopentylbenzam…
7R9Z 1.72 Å, LC3A in complex with Fragment 2-3
7R9W 1.75 Å, LC3A in complex with Fragment 1-1
4ZDV 1.8 Å, Crystal structure of LC3 in complex with FAM134B LIR
8T36 1.85 Å, Crystal structure of K49 acetylated LC3A in complex with the LIR of TP53INP2/DOR
8T35 1.9 Å, Crystal structure of K51 acetylated LC3A in complex with the LIR of TP53INP2/DOR
3WAL 2.0 Å, Crystal structure of human LC3A_2-121
8T2L 2.24 Å, Crystal structure of LC3A in complex with the LIR of NSs4
5CX3 2.3 Å, Crystal structure of FYCO1 LIR in complex with LC3A
8T4T 2.36 Å, Crystal structure of LC3A in complex with the LIR of TP53INP2/DOR
5DPR 2.5 Å, Crystal structure of PLEKHM1 LIR-fused human LC3A_2-121

Browse structure collections

About this viewer

MolViewer shows 3WAN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.