3WI0: Polymerase basic protein 2

P453H/I471T mutant of PB2 middle domain from influenza virus A/Puerto Rico/8/34(H1N1). Determined by X-ray diffraction at 2.0 Å resolution. Released 18 Dec 2013.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Influenza A virus
Chains: 1
Atoms: 1,529
Mol. weight: 19.64 kDa
Released: 18 Dec 2013

Explore 3WI0 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3WI0 contains 7 α-helices and 15 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	316-319	4
β-strand	322-325	4	1
β-strand	328-335	8	1
β-strand	338-345	8	2
β-strand	351-358	8	2
β-strand	361-366	6	1
β-strand	370-377	8	1
β-strand	380-388	9	1
α-helix	391-404	14
α-helix	408-412	5
β-strand	421	1	3
α-helix	426	1
β-strand	427	1	3
α-helix	428-429	2
α-helix	430-440	11
α-helix	443-449	7
β-strand	451-453	3	4
β-strand	460-461	2	1
β-strand	462-463	2	5
β-strand	469-470	2	5
β-strand	473-475	3	4
β-strand	478-481	4	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Polymerase basic protein 2	A	protein	174	Influenza A virus	P03428 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3WI0_1 Polymerase basic protein 2 (chains A)
GSHMRISSSFSFGGFTFKRTSGSSVKREEEVLTGNLQTLKIRVHEGYEEFTMVGRRATAI
LRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNFVNRANQRLNPMHQ
LLRHFQKDAKVLFQNWGVEHIDNVMGMIGILPDMTPSTEMSMRGVRISKMGSGC

Primary citation

Conformational Polymorphism of m7GTP in Crystal Structure of the PB2 Middle Domain from Human Influenza A Virus. Tsurumura, T., Qiu, H., Yoshida, T. et al. PLoS One (2013) 8:e82020-e82020. DOI 10.1371/journal.pone.0082020 · PubMed

Other PDB entries of the same protein (UniProt P03428 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4U6O 1.3 Å, Structure of the cap-binding domain of influenza virus polymerase subunit PB2
4ENF 1.32 Å, Crystal structure of the cap-binding domain of polymerase basic protein 2 from influenza…
3A1G 1.7 Å, High-Resolution Crystal Structure of RNA polymerase PB1-PB2 subunits from Influenza A…
3WI1 1.93 Å, P453H/I471T mutant of PB2 middle domain from influenza virus A/Puerto Rico/8/34(H1N1)…
2ZTT 2.1 Å, Crystal Structure of RNA polymerase PB1-PB2 subunits from Influenza A Virus
4J2R 2.42 Å, Middle domain of influenza A virus RNA-dependent polymerase PB2
3CW4 2.7 Å, Large c-terminal domain of influenza a virus RNA-dependent polymerase PB2
7JYW 2.9 Å, Crystal Structure of HLA A*2402 in complex with TYQWIIRNW, an 9-mer influenza epitope
7JYX 2.95 Å, Crystal Structure of HLA A*2402 in complex with TYQWIIRNWET, an 11-mer epitope from…

Browse structure collections

About this viewer

MolViewer shows 3WI0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.