4J2R: Polymerase basic protein 2

Middle domain of influenza A virus RNA-dependent polymerase PB2. Determined by X-ray diffraction at 2.42 Å resolution. Released 5 Feb 2014.

Method: X-ray diffraction
Resolution: 2.42 Å
Organism: Influenza A virus
Chains: 2
Atoms: 2,653
Mol. weight: 39.21 kDa
Released: 5 Feb 2014

Explore 4J2R in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4J2R contains 15 α-helices and 30 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	322-325	4	1
β-strand	328-334	7	1
β-strand	341-345	5	2
β-strand	351-355	5	2
α-helix	356-358	3
β-strand	361-366	6	1
β-strand	370-377	8	1
β-strand	380-388	9	1
α-helix	391-405	15
α-helix	408-412	5
β-strand	421	1	3
α-helix	426	1
β-strand	427	1	3
α-helix	428-429	2
α-helix	430-440	11
α-helix	443-447	5
β-strand	451-453	3	4
α-helix	456-458	3
α-helix	460	1
β-strand	461	1	1
β-strand	462-463	2	5
β-strand	469-470	2	5
β-strand	473-475	3	4
β-strand	478-480	3	1

Chain B: 6 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	323-325	3	6
β-strand	328-335	8	6
β-strand	338-345	8	7
β-strand	351-358	8	7
β-strand	361-366	6	6
β-strand	370-377	8	6
β-strand	380-388	9	6
α-helix	391-405	15
α-helix	408-412	5
β-strand	421	1	8
α-helix	426	1
β-strand	427	1	8
α-helix	428-429	2
α-helix	430-440	11
α-helix	443-448	6
β-strand	451-453	3	9
β-strand	461	1	6
β-strand	462-463	2	10
β-strand	469-470	2	10
β-strand	473-475	3	9
β-strand	478-480	3	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Polymerase basic protein 2	A, B	protein	174	Influenza A virus	P03428 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4J2R_1 Polymerase basic protein 2 (chains A, B)
GSHMRISSSFSFGGFTFKRTSGSSVKREEEVLTGNLQTLKIRVHEGYEEFTMVGRRATAI
LRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNFVNRANQRLNPMHQ
LLRHFQKDAKVLFQNWGVEPIDNVMGMIGILPDMTPSIEMSMRGVRISKMGSGC

Primary citation

Crystallization and preliminary X-ray diffraction studies of a surface mutant of the middle domain of PB2 from human influenza A (H1N1) virus. Tsurumura, T., Qiu, H., Yoshida, T. et al. Acta Crystallogr Sect F Struct Biol Cryst Commun (2014) 70:72-75. DOI 10.1107/S2053230X13032603 · PubMed

Other PDB entries of the same protein (UniProt P03428 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4U6O 1.3 Å, Structure of the cap-binding domain of influenza virus polymerase subunit PB2
4ENF 1.32 Å, Crystal structure of the cap-binding domain of polymerase basic protein 2 from influenza…
3A1G 1.7 Å, High-Resolution Crystal Structure of RNA polymerase PB1-PB2 subunits from Influenza A…
3WI1 1.93 Å, P453H/I471T mutant of PB2 middle domain from influenza virus A/Puerto Rico/8/34(H1N1)…
3WI0 2.0 Å, P453H/I471T mutant of PB2 middle domain from influenza virus A/Puerto Rico/8/34(H1N1)
2ZTT 2.1 Å, Crystal Structure of RNA polymerase PB1-PB2 subunits from Influenza A Virus
3CW4 2.7 Å, Large c-terminal domain of influenza a virus RNA-dependent polymerase PB2
7JYW 2.9 Å, Crystal Structure of HLA A*2402 in complex with TYQWIIRNW, an 9-mer influenza epitope
7JYX 2.95 Å, Crystal Structure of HLA A*2402 in complex with TYQWIIRNWET, an 11-mer epitope from…

Browse structure collections

About this viewer

MolViewer shows 4J2R directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.