4U6O: Polymerase basic protein 2

Structure of the cap-binding domain of influenza virus polymerase subunit PB2. Determined by X-ray diffraction at 1.3 Å resolution. Released 7 Oct 2015.

Method: X-ray diffraction
Resolution: 1.3 Å
Organism: Influenza A virus (strain A/Puerto Rico/8/1934 H1N1)
Chains: 2
Atoms: 3,012
Mol. weight: 37.97 kDa
Ligands: PO4
Released: 7 Oct 2015

Explore 4U6O in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4U6O contains 9 α-helices and 26 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	323-325	3	1
β-strand	328-335	8	1
β-strand	338-345	8	2
α-helix	350	1
β-strand	351-358	8	2
β-strand	361-366	6	1
β-strand	370-377	8	1
β-strand	380-388	9	1
α-helix	391-405	15
α-helix	408-411	4
α-helix	430-440	11
α-helix	443-449	7
β-strand	451-453	3	3
β-strand	461	1	1
β-strand	462-463	2	4
β-strand	469-470	2	4
β-strand	473-475	3	3
β-strand	478-480	3	1

Chain B: 4 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	322-325	4	5
β-strand	328-335	8	5
β-strand	338-345	8	6
β-strand	351-358	8	6
β-strand	361-366	6	5
β-strand	370-377	8	5
β-strand	380-388	9	5
α-helix	391-405	15
α-helix	408-411	4
α-helix	430-440	11
α-helix	443-449	7
β-strand	451-453	3	7
β-strand	461	1	5
β-strand	462-463	2	8
β-strand	469-470	2	8
β-strand	473-475	3	7
β-strand	478-480	3	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Polymerase basic protein 2	A, B	protein	166	Influenza A virus (strain A/Puerto Rico/8/1934 H1N1)	P03428 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4U6O_1 Polymerase basic protein 2 (chains A, B)
RISSSFSFGGFTFKRTSGSSVKREEEVLTGNLQTLKIRVHEGYEEFTMVGRRATAILRKA
TRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNFVNRANQRLNPMHQLLRH
FQKDAKVLFQNWGVEPIDNVMGMIGILPDMTPSIEMSMRGVRISKM

Ligands and cofactors

ID	Name	Formula	Copies
PO4	Phosphate ion	O4 P	2

Primary citation

STRUCTURE OF THE CAP-BINDING DOMAIN OF INFLUENZA VIRUS POLYMERASE SUBUNIT PB2. Fukushima, K., Takimoto-Kamimura, M. To be published.

Other PDB entries of the same protein (UniProt P03428 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4ENF 1.32 Å, Crystal structure of the cap-binding domain of polymerase basic protein 2 from influenza…
3A1G 1.7 Å, High-Resolution Crystal Structure of RNA polymerase PB1-PB2 subunits from Influenza A…
3WI1 1.93 Å, P453H/I471T mutant of PB2 middle domain from influenza virus A/Puerto Rico/8/34(H1N1)…
3WI0 2.0 Å, P453H/I471T mutant of PB2 middle domain from influenza virus A/Puerto Rico/8/34(H1N1)
2ZTT 2.1 Å, Crystal Structure of RNA polymerase PB1-PB2 subunits from Influenza A Virus
4J2R 2.42 Å, Middle domain of influenza A virus RNA-dependent polymerase PB2
3CW4 2.7 Å, Large c-terminal domain of influenza a virus RNA-dependent polymerase PB2
7JYW 2.9 Å, Crystal Structure of HLA A*2402 in complex with TYQWIIRNW, an 9-mer influenza epitope
7JYX 2.95 Å, Crystal Structure of HLA A*2402 in complex with TYQWIIRNWET, an 11-mer epitope from…

Browse structure collections

About this viewer

MolViewer shows 4U6O directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.