3WO3: IL-18

Crystal structure of IL-18 in complex with IL-18 receptor alpha. Determined by X-ray diffraction at 3.1 Å resolution. Released 17 Dec 2014.

Method: X-ray diffraction
Resolution: 3.1 Å
Organism: Homo sapiens
Chains: 12
Atoms: 22,047
Mol. weight: 346.96 kDa
Ligands: NAG
Released: 17 Dec 2014

Explore 3WO3 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3WO3 contains 57 α-helices and 238 β-strands across 12 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, C, G and K: 4 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	2-14	13	1
β-strand	18-22	5	1
β-strand	28-32	5	1
α-helix	35-40	6
β-strand	47-54	8	1
β-strand	60-67	8	1
β-strand	71-75	5	1
α-helix	77-79	3
β-strand	82-85	4	1
α-helix	87-89	3
β-strand	91-92	2	1
β-strand	101-106	6	1
β-strand	109-117	9	1
β-strand	123-130	8	1
β-strand	133-140	8	1
α-helix	147-149	3
β-strand	151-155	5	1

Chain B: 6 helices, 27 β-strands

Element	Residues	Length	Sheet
α-helix	20-22	3
β-strand	27-31	5	2
β-strand	34-39	6	3
β-strand	54-59	6	2
β-strand	66-67	2	2
β-strand	76-78	3	3
β-strand	82-88	7	3
α-helix	90-92	3
β-strand	94-100	7	2
β-strand	103-112	10	2
α-helix	113-114	2
α-helix	122-124	3
β-strand	125-131	7	4
β-strand	135-139	5	5
β-strand	149-156	8	4
β-strand	160	1	4
β-strand	170-174	5	5
α-helix	177-179	3
β-strand	181-191	11	4
β-strand	194-207	14	4
β-strand	216-217	2	6
β-strand	222-226	5	7
β-strand	233-241	9	6
β-strand	246-250	5	7
β-strand	254	1	8
β-strand	256	1	8
β-strand	261-263	3	6
α-helix	264-266	3
β-strand	267-270	4	6
β-strand	276-284	9	6
β-strand	292	1	7
β-strand	295-302	8	7
β-strand	305-314	10	7

Chain D: 7 helices, 27 β-strands

Element	Residues	Length	Sheet
β-strand	27-31	5	10
β-strand	34-39	6	11
β-strand	54-59	6	10
β-strand	66-67	2	10
α-helix	68	1
β-strand	76-78	3	11
β-strand	82-88	7	11
α-helix	90-92	3
β-strand	94-100	7	10
β-strand	103-112	10	10
α-helix	113-114	2
α-helix	122-124	3
β-strand	125-131	7	12
β-strand	135-139	5	13
β-strand	149-156	8	12
β-strand	160	1	12
β-strand	170-174	5	13
α-helix	177-179	3
β-strand	181-191	11	12
β-strand	194-207	14	12
α-helix	212-215	4
β-strand	216-217	2	14
β-strand	222-226	5	15
β-strand	233-241	9	14
β-strand	246-250	5	15
β-strand	254	1	16
β-strand	256	1	16
β-strand	261-263	3	14
α-helix	264-266	3
β-strand	267-270	4	14
β-strand	276-284	9	14
β-strand	292	1	15
β-strand	295-302	8	15
β-strand	305-314	10	15

Chain E: 3 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	2-14	13	17
β-strand	18-22	5	17
β-strand	28-32	5	17
α-helix	35-40	6
β-strand	47-54	8	17
β-strand	60-67	8	17
β-strand	71-75	5	17
α-helix	77-79	3
β-strand	82-85	4	17
α-helix	87-89	3
β-strand	91-92	2	17
β-strand	101-106	6	17
β-strand	109-117	9	17
β-strand	123-130	8	17
β-strand	133-140	8	17
β-strand	151-155	5	17

Chain F: 5 helices, 27 β-strands

Element	Residues	Length	Sheet
β-strand	27-31	5	18
β-strand	34-39	6	19
β-strand	55-59	5	18
β-strand	66-67	2	18
β-strand	76-77	2	19
β-strand	82-88	7	19
α-helix	90-92	3
β-strand	94-100	7	18
β-strand	103-112	10	18
β-strand	125-131	7	20
β-strand	135-139	5	21
β-strand	149-156	8	20
β-strand	160	1	20
β-strand	170-174	5	21
α-helix	177-179	3
β-strand	181-190	10	20
β-strand	195-207	13	20
α-helix	212-215	4
β-strand	216-217	2	22
β-strand	222-226	5	23
β-strand	233-241	9	22
β-strand	246-250	5	23
β-strand	254	1	24
β-strand	256	1	24
β-strand	261-263	3	22
α-helix	264-266	3
β-strand	267-270	4	22
β-strand	276-284	9	22
α-helix	289-291	3
β-strand	292	1	23
β-strand	295-302	8	23
β-strand	305-314	10	23

Chain H: 6 helices, 25 β-strands

Element	Residues	Length	Sheet
α-helix	20-22	3
β-strand	27-31	5	26
β-strand	34-39	6	27
β-strand	55-59	5	26
β-strand	66-67	2	26
β-strand	76-78	3	27
β-strand	82-88	7	27
α-helix	90-92	3
β-strand	94-100	7	26
β-strand	103-112	10	26
β-strand	125-131	7	28
β-strand	135-139	5	29
α-helix	145-148	4
β-strand	149-156	8	28
β-strand	160	1	28
β-strand	170-174	5	29
α-helix	177-179	3
β-strand	181-190	10	28
β-strand	195-207	13	28
α-helix	212-215	4
β-strand	216-217	2	30
β-strand	222-227	6	31
β-strand	233-241	9	30
β-strand	246-250	5	31
β-strand	261-263	3	30
α-helix	264-266	3
β-strand	267-270	4	30
β-strand	276-284	9	30
β-strand	292	1	31
β-strand	295-302	8	31
β-strand	305-315	11	31

Chain I: 3 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	2-14	13	32
β-strand	18-22	5	32
β-strand	28-32	5	32
α-helix	35-39	5
β-strand	47-54	8	32
β-strand	60-67	8	32
β-strand	71-75	5	32
α-helix	77-79	3
β-strand	82-85	4	32
α-helix	87-89	3
β-strand	91-92	2	32
β-strand	101-106	6	32
β-strand	109-117	9	32
β-strand	123-128	6	32
β-strand	135-140	6	32
β-strand	151-155	5	32

Chain J: 6 helices, 27 β-strands

Element	Residues	Length	Sheet
β-strand	27-31	5	33
β-strand	36	1	34
α-helix	39-40	2
β-strand	57-58	2	35
β-strand	65-66	2	35
β-strand	85	1	34
α-helix	90-92	3
β-strand	96	1	35
β-strand	107	1	35
β-strand	108-112	5	33
α-helix	122-124	3
β-strand	125-131	7	36
β-strand	135-139	5	37
β-strand	149-156	8	36
β-strand	160	1	36
β-strand	170-174	5	37
α-helix	177-179	3
β-strand	181-191	11	36
β-strand	194-207	14	36
α-helix	212-215	4
β-strand	216-217	2	38
β-strand	222-226	5	39
β-strand	233-241	9	38
β-strand	246-250	5	39
β-strand	254	1	40
β-strand	256	1	40
β-strand	261-263	3	38
α-helix	264-266	3
β-strand	267-270	4	38
β-strand	276-284	9	38
β-strand	292	1	39
β-strand	295-302	8	39
β-strand	305-314	10	39

1 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Interleukin-18	A, C, E, G, I, K	protein	157	Homo sapiens	Q14116 (AlphaFold model)
Interleukin-18 receptor 1	B, D, F, H, J, L	protein	312	Homo sapiens	Q13478 (AlphaFold model)

Sequence of entity 1 (A, C, E, G, I, K), FASTA

>3WO3_1 Interleukin-18 (chains A, C, E, G, I, K)
YFGKLESKLSVIRNLNDQVLFIDQGNRPLFEDMTDSDCRDNAPRTIFIISMYKDSQPRGM
AVTISVKCEKISTLSCENKIISFKEMNPPDNIKDTKSDIIFFQRSVPGHDNKMQFESSSY
EGYFLACEKERDLFKLILKKEDELGDRSIMFTVQNED

Sequence of entity 2 (B, D, F, H, J, L), FASTA

>3WO3_2 Interleukin-18 receptor 1 (chains B, D, F, H, J, L)
GPESCTSRPHITVVEGEPFYLKHCSCSLAHEIETTTKSWYKSSGSQEHVELNPRSSSRIA
LHDCVLEFWPVELNDTGSYFFQMKNYTQKWKLNVIRRNKHSCFTERQVTSKIVEVKKFFQ
ITCENSYYQTLVNSTSLYKNCKKLLLENNKNPTIKKNAEFEDQGYYSCVHFLHHNGKLFN
ITKTFNITIVEDRSNIVPVLLGPKLNHVAVELGKNVRLNCSALLNEEDVIYWMFGEENGS
DPNIHEEKEMRIMTPEGKWHASKVLRIENIGESNLNVLYNCTVASTGGTDTKSFILVRKA
DMADIPGHVFTR

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	8

Water and common crystallization additives (SO4) are not listed.

Primary citation

The structural basis for receptor recognition of human interleukin-18. Tsutsumi, N., Kimura, T., Arita, K. et al. Nat Commun (2014) 5:5340-5340. DOI 10.1038/ncomms6340 · PubMed

Other PDB entries of the same protein (UniProt Q14116 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2VXT 1.49 Å, Crystal structure of human IL-18 complexed to murine reference antibody 125-2H Fab
9OD9 1.6 Å, Structure of disulfide-stabilized IL-18 variant
4EKX 1.75 Å, Crystal Structure of YLDV 14L IL-18 Binding Protein in Complex with Human IL-18
7AL7 1.8 Å, The Crystal Structure of Human IL-18 in Complex With Human IL-18 Binding Protein
9OD7 1.9 Å, Structure of disulfide-stabilized IL-18 variant
4XFS 1.91 Å, Structure of IL-18 SER Mutant I
3F62 2.0 Å, Crystal Structure of Human IL-18 in complex with Ectromelia virus IL-18 Binding Protein
4XFT 2.0 Å, Structure of IL-18 SER Mutant III
4HJJ 2.1 Å, Structure Reveals Function of the Dual Variable Domain Immunoglobulin (DVD-Ig) Molecule
3WO2 2.33 Å, Crystal structure of human interleukin-18
4EEE 2.71 Å, Crystal Structure of YLDV 14L IL-18 Binding Protein in Complex with Human IL-18
4R6U 2.8 Å, IL-18 receptor complex

Browse structure collections

About this viewer

MolViewer shows 3WO3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.