SorLA Vps10p domain in ligand-free form. Determined by X-ray diffraction at 2.35 Å resolution. Released 4 Feb 2015.
Explore 3WSX in 3D Show helices and sheets RCSB PDB PDBe
3WSX contains 19 α-helices and 64 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 91-98 | 8 | 1 |
| β-strand | 104-109 | 6 | 2 |
| β-strand | 117-122 | 6 | 2 |
| β-strand | 133-138 | 6 | 2 |
| β-strand | 146-147 | 2 | 2 |
| α-helix | 149-151 | 3 | |
| α-helix | 160-162 | 3 | |
| β-strand | 164-169 | 6 | 3 |
| β-strand | 177-181 | 5 | 3 |
| β-strand | 186-190 | 5 | 3 |
| β-strand | 198-201 | 4 | 3 |
| β-strand | 208-211 | 4 | 4 |
| β-strand | 219-223 | 5 | 4 |
| β-strand | 230-234 | 5 | 4 |
| β-strand | 242-245 | 4 | 4 |
| β-strand | 248-253 | 6 | 5 |
| β-strand | 264-268 | 5 | 5 |
| β-strand | 275-280 | 6 | 5 |
| α-helix | 287-289 | 3 | |
| β-strand | 290-297 | 8 | 5 |
| β-strand | 300-303 | 4 | 6 |
| β-strand | 306-313 | 8 | 6 |
| β-strand | 323-330 | 8 | 6 |
| α-helix | 333-335 | 3 | |
| β-strand | 336-337 | 2 | 6 |
| α-helix | 338 | 1 | |
| β-strand | 339 | 1 | 7 |
| β-strand | 349 | 1 | 8 |
| β-strand | 350-353 | 4 | 9 |
| β-strand | 360-363 | 4 | 9 |
| α-helix | 366-368 | 3 | |
| β-strand | 369-374 | 6 | 9 |
| β-strand | 381 | 1 | 7 |
| β-strand | 383-390 | 8 | 9 |
| β-strand | 391 | 1 | 10 |
| β-strand | 402 | 1 | 8 |
| β-strand | 412 | 1 | 10 |
| β-strand | 414-416 | 3 | 9 |
| α-helix | 417 | 1 | |
| β-strand | 424-428 | 5 | 9 |
| β-strand | 439-443 | 5 | 9 |
| β-strand | 451-452 | 2 | 9 |
| β-strand | 454-455 | 2 | 11 |
| β-strand | 473-474 | 2 | 11 |
| β-strand | 475-478 | 4 | 12 |
| α-helix | 493-494 | 2 | |
| β-strand | 495 | 1 | 12 |
| β-strand | 504-510 | 7 | 12 |
| β-strand | 519-523 | 5 | 12 |
| β-strand | 531-535 | 5 | 12 |
| β-strand | 538-543 | 6 | 13 |
| α-helix | 544-546 | 3 | |
| β-strand | 548-553 | 6 | 13 |
| β-strand | 558 | 1 | 14 |
| β-strand | 560-564 | 5 | 13 |
| β-strand | 572-575 | 4 | 13 |
| β-strand | 581 | 1 | 14 |
| β-strand | 582-588 | 7 | 1 |
| α-helix | 589 | 1 | |
| β-strand | 596-602 | 7 | 1 |
| β-strand | 610-616 | 7 | 1 |
| α-helix | 618-621 | 4 | |
| β-strand | 624 | 1 | 15 |
| α-helix | 625 | 1 | |
| α-helix | 627-629 | 3 | |
| β-strand | 630-633 | 4 | 16 |
| β-strand | 644 | 1 | 17 |
| β-strand | 647-650 | 4 | 17 |
| β-strand | 651-654 | 4 | 16 |
| β-strand | 661 | 1 | 15 |
| β-strand | 671-674 | 4 | 17 |
| α-helix | 679-681 | 3 | |
| β-strand | 682-684 | 3 | 18 |
| α-helix | 685 | 1 | |
| β-strand | 688-690 | 3 | 9 |
| α-helix | 694-696 | 3 | |
| β-strand | 699-701 | 3 | 9 |
| α-helix | 703-705 | 3 | |
| β-strand | 722-724 | 3 | 19 |
| β-strand | 728-730 | 3 | 18 |
| α-helix | 731 | 1 | |
| α-helix | 747 | 1 | |
| β-strand | 748-750 | 3 | 19 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Sortilin-related receptor | A | protein | 734 | Homo sapiens | Q92673 (AlphaFold model) |
>3WSX_1 Sortilin-related receptor (chains A) EVWTQRLHGGSAPLPQDRGFLVVQGDPRELRLWARGDARGASRADEKPLRRKRSAALQPE PIKVYGQVSLNDSHNQMVVHWAGEKSNVIVALARDSLALARPKSSDVYVSYDYGKSFKKI SDKLNFGLGNRSEAVIAQFYHSPADNKRYIFADAYAQYLWITFDFCNTLQGFSIPFRAAD LLLHSKASNLLLGFDRSHPNKQLWKSDDFGQTWIMIQEHVKSFSWGIDPYDKPNTIYIER HEPSGYSTVFRSTDFFQSRENQEVILEEVRDFQLRDKYMFATKVVHLLGSEQQSSVQLWV SFGRKPMRAAQFVTRHPINEYYIADASEDQVFVCVSHSNNRTNLYISEAEGLKFSLSLEN VLYYSPGGAGSDTLVRYFANEPFADFHRVEGLQGVYIATLINGSMNEENMRSVITFDKGG TWEFLQAPAFTGYGEKINCELSQGCSLHLAQRLSQLLNLQLRRMPILSKESAPGLIIATG SVGKNLASKTNVYISSSAGARWREALPGPHYYTWGDHGGIITAIAQGMETNELKYSTNEG ETWKTFIFSEKPVFVYGLLTEPGEKSTVFTIFGSNKENVHSWLILQVNATDALGVPCTEN DYKLWSPSDERGNECLLGHKTVFKRRTPHATCFNGEDFDRPVVVSNCSCTREDYECDFGF KMSEDLSLEVCVPDPEFSGKSYSPPVPCPVGSTYRRTRGYRKISGDTCSGGDVEARLEGE LVPCPSRLENLYFQ
Water and common crystallization additives (EDO) are not listed.
Structural basis for amyloidogenic peptide recognition by sorLA. Kitago, Y., Nagae, M., Nakata, Z. et al. Nat Struct Mol Biol (2015) 22:199-206. DOI 10.1038/nsmb.2954 · PubMed
Other PDB entries of the same protein (UniProt Q92673 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3WSX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.