3WSY: SorLA Vps10p domain

SorLA Vps10p domain in complex with its own propeptide fragment. Determined by X-ray diffraction at 3.11 Å resolution. Released 4 Feb 2015.

Method: X-ray diffraction
Resolution: 3.11 Å
Organism: Homo sapiens
Chains: 2
Atoms: 5,421
Mol. weight: 79.37 kDa
Ligands: NAG
Released: 4 Feb 2015

Explore 3WSY in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3WSY contains 19 α-helices and 62 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 19 helices, 61 β-strands

Element	Residues	Length	Sheet
β-strand	91-97	7	1
β-strand	104-109	6	2
β-strand	117-122	6	2
β-strand	133-138	6	2
β-strand	145-147	3	2
α-helix	149-151	3
α-helix	161-162	2
β-strand	164-169	6	3
β-strand	177-181	5	3
β-strand	186-190	5	3
β-strand	198-201	4	3
β-strand	208-211	4	4
β-strand	219-222	4	4
β-strand	231-234	4	4
β-strand	241-245	5	4
β-strand	248-253	6	5
α-helix	260	1
β-strand	264-269	6	5
β-strand	275-280	6	5
β-strand	290-303	14	5
β-strand	306-313	8	5
α-helix	321-322	2
β-strand	323-330	8	5
α-helix	333-335	3
β-strand	336-337	2	5
α-helix	338	1
β-strand	339-340	2	6
β-strand	346-354	9	7
β-strand	359-365	7	7
β-strand	370-374	5	7
α-helix	375-376	2
β-strand	381-382	2	6
β-strand	383-386	4	7
β-strand	389	1	8
β-strand	391-392	2	9
α-helix	402-405	4
β-strand	411-412	2	9
β-strand	414-416	3	8
β-strand	424-429	6	8
α-helix	435-437	3
β-strand	438-443	6	8
β-strand	451-452	2	8
β-strand	453	1	10
β-strand	458	1	11
β-strand	464	1	11
α-helix	469-471	3
β-strand	474-477	4	10
α-helix	480-485	6
α-helix	491-494	4
β-strand	495-496	2	10
β-strand	504-511	8	10
β-strand	519-523	5	10
β-strand	531-534	4	10
β-strand	538-543	6	12
β-strand	548-553	6	12
β-strand	558	1	1
β-strand	560-564	5	12
β-strand	572-575	4	12
β-strand	581-587	7	1
β-strand	596-603	8	1
β-strand	611-616	6	1
α-helix	618-621	4
β-strand	624	1	13
α-helix	627-629	3
β-strand	630-633	4	14
α-helix	635-637	3
β-strand	644	1	14
β-strand	647-654	8	14
β-strand	661	1	13
β-strand	670-674	5	14
α-helix	679-681	3
β-strand	682-684	3	15
α-helix	685	1
β-strand	688-690	3	16
β-strand	699-701	3	16
β-strand	721-724	4	17
β-strand	728-730	3	15
α-helix	740-745	6
α-helix	747	1
β-strand	748-751	4	17

Chain C: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	48-51	4	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Sortilin-related receptor	A	protein	678	Homo sapiens	Q92673 (AlphaFold model)
peptide from Sortilin-related receptor	C	protein	15	Homo sapiens	Q92673 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3WSY_1 Sortilin-related receptor (chains A)
EQPEPIKVYGQVSLNDSHNQMVVHWAGEKSNVIVALARDSLALARPKSSDVYVSYDYGKS
FKKISDKLNFGLGNRSEAVIAQFYHSPADNKRYIFADAYAQYLWITFDFCNTLQGFSIPF
RAADLLLHSKASNLLLGFDRSHPNKQLWKSDDFGQTWIMIQEHVKSFSWGIDPYDKPNTI
YIERHEPSGYSTVFRSTDFFQSRENQEVILEEVRDFQLRDKYMFATKVVHLLGSEQQSSV
QLWVSFGRKPMRAAQFVTRHPINEYYIADASEDQVFVCVSHSNNRTNLYISEAEGLKFSL
SLENVLYYSPGGAGSDTLVRYFANEPFADFHRVEGLQGVYIATLINGSMNEENMRSVITF
DKGGTWEFLQAPAFTGYGEKINCELSQGCSLHLAQRLSQLLNLQLRRMPILSKESAPGLI
IATGSVGKNLASKTNVYISSSAGARWREALPGPHYYTWGDHGGIITAIAQGMETNELKYS
TNEGETWKTFIFSEKPVFVYGLLTEPGEKSTVFTIFGSNKENVHSWLILQVNATDALGVP
CTENDYKLWSPSDERGNECLLGHKTVFKRRTPHATCFNGEDFDRPVVVSNCSCTREDYEC
DFGFKMSEDLSLEVCVPDPEFSGKSYSPPVPCPVGSTYRRTRGYRKISGDTCSGGDVEAR
LEGELVPCPSRLENLYFQ

Sequence of entity 2 (C), FASTA

>3WSY_2 peptide from Sortilin-related receptor (chains C)
LPQDRGFLVVQGDPR

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	5

Primary citation

Structural basis for amyloidogenic peptide recognition by sorLA. Kitago, Y., Nagae, M., Nakata, Z. et al. Nat Struct Mol Biol (2015) 22:199-206. DOI 10.1038/nsmb.2954 · PubMed

Other PDB entries of the same protein (UniProt Q92673 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3G2S 1.7 Å, VHS Domain of human GGA1 complexed with SorLA C-terminal Peptide
3G2T 2.0 Å, VHS Domain of human GGA1 complexed with SorLA C-terminal Phosphopeptide
3WSX 2.35 Å, SorLA Vps10p domain in ligand-free form
3WSZ 3.2 Å, SorLA Vps10p domain in complex with Abeta-derived peptide
7VT0 3.4 Å, Dimer structure of SORLA
2DM4 Solution structure of the second fn3 domain of human sorLA/LR11

Browse structure collections

About this viewer

MolViewer shows 3WSY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.