3WSZ: SorLA Vps10p domain

SorLA Vps10p domain in complex with Abeta-derived peptide. Determined by X-ray diffraction at 3.2 Å resolution. Released 4 Feb 2015.

Method: X-ray diffraction
Resolution: 3.2 Å
Organism: Homo sapiens
Chains: 2
Atoms: 4,581
Mol. weight: 78.18 kDa
Ligands: NAG
Released: 4 Feb 2015

Explore 3WSZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3WSZ contains 9 α-helices and 54 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 53 β-strands

Element	Residues	Length	Sheet
β-strand	91-96	6	1
β-strand	104-109	6	2
β-strand	117-122	6	2
β-strand	134-138	5	2
β-strand	146-147	2	2
α-helix	149-151	3
β-strand	164-169	6	3
β-strand	177-181	5	3
β-strand	186-190	5	3
β-strand	198-201	4	3
β-strand	208-211	4	4
β-strand	219-222	4	4
β-strand	231-234	4	4
β-strand	242-245	4	4
β-strand	248-253	6	5
α-helix	260	1
β-strand	264-269	6	5
β-strand	275-280	6	5
β-strand	291-292	2	5
β-strand	297-303	7	5
β-strand	306-311	6	5
β-strand	327-330	4	5
β-strand	333-337	5	5
α-helix	338-339	2
β-strand	340	1	6
β-strand	346-355	10	7
β-strand	358-365	8	7
β-strand	370-374	5	7
β-strand	382	1	6
β-strand	383-387	5	7
β-strand	389	1	8
β-strand	391-392	2	9
α-helix	402-405	4
β-strand	411-412	2	9
β-strand	414-416	3	8
β-strand	424-429	6	8
β-strand	438-443	6	8
β-strand	451-452	2	8
β-strand	474-478	5	10
α-helix	480-485	6
β-strand	495-496	2	10
β-strand	504-511	8	10
β-strand	519-523	5	10
β-strand	531-534	4	10
β-strand	538-543	6	11
β-strand	548-553	6	11
β-strand	558	1	12
β-strand	560-564	5	11
β-strand	572-575	4	11
β-strand	581	1	12
β-strand	582-587	6	1
β-strand	596-602	7	1
α-helix	603	1
β-strand	610-616	7	1
α-helix	618-621	4
β-strand	624	1	13
α-helix	627-629	3
β-strand	630-633	4	14
α-helix	635-638	4
β-strand	649-654	6	14
β-strand	661	1	13
β-strand	670-672	3	14

Chain C: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	12-13	2	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Sortilin-related receptor	A	protein	678	Homo sapiens	Q92673 (AlphaFold model)
10-mer peptide	C	protein	10	Homo sapiens

Sequence of entity 1 (A), FASTA

>3WSZ_1 Sortilin-related receptor (chains A)
EQPEPIKVYGQVSLNDSHNQMVVHWAGEKSNVIVALARDSLALARPKSSDVYVSYDYGKS
FKKISDKLNFGLGNRSEAVIAQFYHSPADNKRYIFADAYAQYLWITFDFCNTLQGFSIPF
RAADLLLHSKASNLLLGFDRSHPNKQLWKSDDFGQTWIMIQEHVKSFSWGIDPYDKPNTI
YIERHEPSGYSTVFRSTDFFQSRENQEVILEEVRDFQLRDKYMFATKVVHLLGSEQQSSV
QLWVSFGRKPMRAAQFVTRHPINEYYIADASEDQVFVCVSHSNNRTNLYISEAEGLKFSL
SLENVLYYSPGGAGSDTLVRYFANEPFADFHRVEGLQGVYIATLINGSMNEENMRSVITF
DKGGTWEFLQAPAFTGYGEKINCELSQGCSLHLAQRLSQLLNLQLRRMPILSKESAPGLI
IATGSVGKNLASKTNVYISSSAGARWREALPGPHYYTWGDHGGIITAIAQGMETNELKYS
TNEGETWKTFIFSEKPVFVYGLLTEPGEKSTVFTIFGSNKENVHSWLILQVNATDALGVP
CTENDYKLWSPSDERGNECLLGHKTVFKRRTPHATCFNGEDFDRPVVVSNCSCTREDYEC
DFGFKMSEDLSLEVCVPDPEFSGKSYSPPVPCPVGSTYRRTRGYRKISGDTCSGGDVEAR
LEGELVPCPSRLENLYFQ

Sequence of entity 2 (C), FASTA

>3WSZ_2 10-mer peptide (chains C)
AAAAAAAAAA

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	4

Primary citation

Structural basis for amyloidogenic peptide recognition by sorLA. Kitago, Y., Nagae, M., Nakata, Z. et al. Nat Struct Mol Biol (2015) 22:199-206. DOI 10.1038/nsmb.2954 · PubMed

Other PDB entries of the same protein (UniProt Q92673 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3G2S 1.7 Å, VHS Domain of human GGA1 complexed with SorLA C-terminal Peptide
3G2T 2.0 Å, VHS Domain of human GGA1 complexed with SorLA C-terminal Phosphopeptide
3WSX 2.35 Å, SorLA Vps10p domain in ligand-free form
3WSY 3.11 Å, SorLA Vps10p domain in complex with its own propeptide fragment
7VT0 3.4 Å, Dimer structure of SORLA
2DM4 Solution structure of the second fn3 domain of human sorLA/LR11

Browse structure collections

About this viewer

MolViewer shows 3WSZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.