3WTV: Runt-related transcription factor 1
Crystal structure of the complex comprised of ETS1(V170G), RUNX1, CBFBETA, and the tcralpha gene enhancer DNA. Determined by X-ray diffraction at 2.7 Å resolution. Released 20 Aug 2014.
- Method
- X-ray diffraction
- Resolution
- 2.7 Å
- Organisms
- Mus musculus, Homo sapiens
- Chains
- 10
- Atoms
- 7,002
- Mol. weight
- 135.9 kDa
- Released
- 20 Aug 2014
Explore 3WTV in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
3WTV contains 27 α-helices and 54 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 2 helices, 13 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 62-64 | 3 | 1 |
| β-strand | 70-73 | 4 | 1 |
| β-strand | 78-80 | 3 | 2 |
| α-helix | 83-85 | 3 | |
| β-strand | 90-93 | 4 | 1 |
| β-strand | 102-106 | 5 | 3 |
| β-strand | 117-118 | 2 | 4 |
| β-strand | 121-123 | 3 | 3 |
| β-strand | 124-125 | 2 | 1 |
| β-strand | 128-130 | 3 | 1 |
| β-strand | 135-136 | 2 | 4 |
| β-strand | 146-152 | 7 | 3 |
| α-helix | 157 | 1 | |
| β-strand | 158-166 | 9 | 3 |
| β-strand | 167-169 | 3 | 2 |
Chain B: 4 helices, 11 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 8-13 | 6 | |
| α-helix | 16-22 | 7 | |
| β-strand | 25-29 | 5 | 3 |
| α-helix | 37-49 | 13 | |
| β-strand | 52-57 | 6 | 3 |
| β-strand | 62-67 | 6 | 3 |
| β-strand | 87 | 1 | 5 |
| β-strand | 92 | 1 | 6 |
| β-strand | 94-95 | 2 | 6 |
| β-strand | 96 | 1 | 5 |
| β-strand | 98-103 | 6 | 3 |
| β-strand | 106-112 | 7 | 3 |
| β-strand | 114-115 | 2 | 6 |
| β-strand | 120-127 | 8 | 3 |
| α-helix | 129-139 | 11 | |
Chain C: 9 helices, 4 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 323-326 | 4 | |
| α-helix | 335-336 | 2 | |
| α-helix | 337-345 | 9 | |
| α-helix | 348-351 | 4 | |
| β-strand | 354-356 | 3 | 7 |
| β-strand | 362-365 | 4 | 7 |
| α-helix | 368-379 | 12 | |
| α-helix | 386-394 | 9 | |
| α-helix | 396-399 | 4 | |
| β-strand | 402-404 | 3 | 7 |
| β-strand | 411-414 | 4 | 7 |
| α-helix | 418-422 | 5 | |
| α-helix | 426-433 | 8 | |
Chain F: 2 helices, 15 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 62-64 | 3 | 8 |
| β-strand | 70-73 | 4 | 8 |
| α-helix | 74-76 | 3 | |
| β-strand | 78-80 | 3 | 9 |
| α-helix | 83-85 | 3 | |
| β-strand | 90-93 | 4 | 8 |
| β-strand | 102-108 | 7 | 10 |
| β-strand | 109 | 1 | 11 |
| β-strand | 112 | 1 | 11 |
| β-strand | 117-118 | 2 | 12 |
| β-strand | 121-123 | 3 | 10 |
| β-strand | 124-125 | 2 | 8 |
| β-strand | 128-130 | 3 | 8 |
| β-strand | 135-136 | 2 | 12 |
| β-strand | 146-152 | 7 | 10 |
| β-strand | 158-166 | 9 | 10 |
| β-strand | 167-169 | 3 | 9 |
Chain G: 4 helices, 7 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 8-12 | 5 | |
| α-helix | 16-19 | 4 | |
| β-strand | 26-29 | 4 | 10 |
| α-helix | 37-50 | 14 | |
| β-strand | 52-57 | 6 | 10 |
| β-strand | 62-67 | 6 | 10 |
| β-strand | 86-87 | 2 | 10 |
| β-strand | 94-103 | 10 | 10 |
| β-strand | 106-115 | 10 | 10 |
| β-strand | 120-127 | 8 | 10 |
| α-helix | 129-136 | 8 | |
Chain H: 6 helices, 4 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 337-346 | 10 | |
| β-strand | 356 | 1 | 13 |
| β-strand | 363-364 | 2 | 13 |
| α-helix | 368-378 | 11 | |
| α-helix | 386-394 | 9 | |
| α-helix | 396-399 | 4 | |
| β-strand | 404 | 1 | 13 |
| β-strand | 411-412 | 2 | 13 |
| α-helix | 426-429 | 4 | |
| α-helix | 430-432 | 3 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Runt-related transcription factor 1 | A, F | protein | 204 | Mus musculus | Q03347 (AlphaFold model) |
| Core-binding factor subunit beta | B, G | protein | 142 | Mus musculus | Q08024 (AlphaFold model) |
| Protein C-ets-1 | C, H | protein | 166 | Homo sapiens | P14921 (AlphaFold model) |
| DNA (5'-d(*gp*ap*ap*gp*cp*cp*ap*cp*ap*tp*cp*cp*tp*cp*t)-3') | D, I | DNA | 15 | | |
| DNA (5'-d(*ap*gp*ap*gp*gp*ap*tp*gp*tp*gp*gp*cp*tp*tp*c)-3') | E, J | DNA | 15 | | |
Sequence of entity 1 (A, F), FASTA
>3WTV_1 Runt-related transcription factor 1 (chains A, F)
GELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVAKGDVPDGTLVTVMAGNDENYSAELRN
ATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITGDGPREPRRH
RQKLDDQTKPGSLSFSERLSELEQLRRTAMRVSPHHPAPTPNPRASLNHSTAFNPQPQSQ
MQDARQIQPSPPWSYDQSYQYLGS
Sequence of entity 2 (B, G), FASTA
>3WTV_2 Core-binding factor subunit beta (chains B, G)
MPRVVPDQRSKFENEEFFRKLSRECEIKYTGFRDRPHEERQTRFQNACRDGRSEIAFVAT
GTNLSLQFFPASWQGEQRQTPSREYVDLEREAGKVYLKAPMILNGVCVIWKGWIDLHRLD
GMGCLEFDEERAQQEDALAQQA
Sequence of entity 3 (C, H), FASTA
>3WTV_3 Protein C-ets-1 (chains C, H)
SLQRVPSYDSFDSEDYPAALPNHKPKGTFKDYVRDRADLNKDKPVIPAAALAGYTGSGPI
QLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRY
YYDKNIIHKTAGKRYVYRFVCDLQSLLGYTPEELHAMLDVKPDADE
Sequence of entity 4 (D, I), FASTA
>3WTV_4 DNA (5'-D(*GP*AP*AP*GP*CP*CP*AP*CP*AP*TP*CP*CP*TP*CP*T)-3') (chains D, I)
GAAGCCACATCCTCT
Sequence of entity 5 (E, J), FASTA
>3WTV_5 DNA (5'-D(*AP*GP*AP*GP*GP*AP*TP*GP*TP*GP*GP*CP*TP*TP*C)-3') (chains E, J)
AGAGGATGTGGCTTC
Primary citation
A novel allosteric mechanism on protein-DNA interactions underlying the phosphorylation-dependent regulation of Ets1 target gene expressions. Shiina, M., Hamada, K., Inoue-Bungo, T. et al. J Mol Biol (2015) 427:1655-1669. DOI 10.1016/j.jmb.2014.07.020 · PubMed
Other PDB entries of the same protein (UniProt Q03347 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 1EAQ 1.25 Å, The RUNX1 Runt domain at 1.25A resolution: A structural switch and specifically bound…
- 1EAO 1.4 Å, THE RUNX1 Runt domain at 1.4A resolution: a structural switch and specifically bound…
- 1EAN 1.7 Å, THE RUNX1 Runt domain at 1.70A resolution: A structural switch and specifically bound…
- 4L18 2.3 Å, Crystal structure of Runx1 and Ets1 bound to TCR alpha promoter (crystal form 3)
- 3WTS 2.35 Å, Crystal structure of the complex comprised of ETS1, RUNX1, CBFBETA, and the tcralpha…
- 3WTT 2.35 Å, Crystal structure of the complex comprised of phosphorylated ETS1, RUNX1, CBFBETA, and…
- 3WU1 2.4 Å, Crystal structure of the ETS1-RUNX1-DNA ternary complex
- 4L0Y 2.5 Å, Crystal structure of Runx1 and Ets1 bound to TCR alpha promoter (crystal form 1)
- 2J6W 2.6 Å, R164N mutant of the RUNX1 Runt domain
- 1HJC 2.65 Å, Crystal structure of runx-1/AML1/CBFALPHA runt domain bound to a DNA fragment from the…
- 3WTU 2.7 Å, Crystal structure of the complex comprised of ETS1 (V170A), RUNX1, CBFBETA, and the…
- 3WTY 2.7 Å, Crystal structure of the complex comprised of ETS1(G333P), RUNX1, CBFBETA, and the…
Browse structure collections
About this viewer
MolViewer shows 3WTV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.