3WU1: ETS1-RUNX1-DNA ternary complex

Crystal structure of the ETS1-RUNX1-DNA ternary complex. Determined by X-ray diffraction at 2.4 Å resolution. Released 20 Aug 2014.

Method: X-ray diffraction
Resolution: 2.4 Å
Organisms: Mus musculus, Homo sapiens
Chains: 4
Atoms: 2,624
Mol. weight: 36.31 kDa
Released: 20 Aug 2014

Explore 3WU1 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3WU1 contains 8 α-helices and 19 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	59-61	3
β-strand	63-64	2	1
β-strand	70-72	3	1
β-strand	78-80	3	2
α-helix	83-85	3
β-strand	90-93	4	1
β-strand	102-106	5	3
β-strand	107	1	4
β-strand	115	1	4
β-strand	117-118	2	5
β-strand	121-123	3	3
β-strand	124-125	2	1
β-strand	128-130	3	1
β-strand	135-136	2	5
β-strand	146-152	7	3
β-strand	158-166	9	3
β-strand	167-169	3	2

Chain B: 6 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	337-345	9
α-helix	348-352	5
β-strand	355-356	2	6
β-strand	362-364	3	6
α-helix	368-379	12
α-helix	386-399	14
β-strand	402-404	3	6
β-strand	411-414	4	6
α-helix	418-422	5
α-helix	426-432	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Runt-related transcription factor 1	A	protein	123	Mus musculus	Q03347 (AlphaFold model)
Protein C-ets-1	B	protein	109	Homo sapiens	P14921 (AlphaFold model)
DNA (5'-d(gpgpapapgpcpcpapcpaptpcpcptpcpt)-3')	C	DNA	16
DNA (5'-d(cpapgpapgpgpaptpgptpgpgpcptptpc)-3')	D	DNA	16

Sequence of entity 1 (A), FASTA

>3WU1_1 Runt-related transcription factor 1 (chains A)
LADHPGELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYS
AELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPR
EPR

Sequence of entity 2 (B), FASTA

>3WU1_2 Protein C-ets-1 (chains B)
GPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRG
LRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYTPEELHAMLDVKPDADE

Sequence of entity 3 (C), FASTA

>3WU1_3 DNA (5'-D(*GP*GP*AP*AP*GP*CP*CP*AP*CP*AP*TP*CP*CP*TP*CP*T)-3') (chains C)
GGAAGCCACATCCTCT

Sequence of entity 4 (D), FASTA

>3WU1_4 DNA (5'-D(*CP*AP*GP*AP*GP*GP*AP*TP*GP*TP*GP*GP*CP*TP*TP*C)-3') (chains D)
CAGAGGATGTGGCTTC

Primary citation

A novel allosteric mechanism on protein-DNA interactions underlying the phosphorylation-dependent regulation of Ets1 target gene expressions. Shiina, M., Hamada, K., Inoue-Bungo, T. et al. J Mol Biol (2015) 427:1655-1669. DOI 10.1016/j.jmb.2014.07.020 · PubMed

Other PDB entries of the same protein (UniProt Q03347 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1EAQ 1.25 Å, The RUNX1 Runt domain at 1.25A resolution: A structural switch and specifically bound…
1EAO 1.4 Å, THE RUNX1 Runt domain at 1.4A resolution: a structural switch and specifically bound…
1EAN 1.7 Å, THE RUNX1 Runt domain at 1.70A resolution: A structural switch and specifically bound…
4L18 2.3 Å, Crystal structure of Runx1 and Ets1 bound to TCR alpha promoter (crystal form 3)
3WTS 2.35 Å, Crystal structure of the complex comprised of ETS1, RUNX1, CBFBETA, and the tcralpha…
3WTT 2.35 Å, Crystal structure of the complex comprised of phosphorylated ETS1, RUNX1, CBFBETA, and…
4L0Y 2.5 Å, Crystal structure of Runx1 and Ets1 bound to TCR alpha promoter (crystal form 1)
2J6W 2.6 Å, R164N mutant of the RUNX1 Runt domain
1HJC 2.65 Å, Crystal structure of runx-1/AML1/CBFALPHA runt domain bound to a DNA fragment from the…
3WTU 2.7 Å, Crystal structure of the complex comprised of ETS1 (V170A), RUNX1, CBFBETA, and the…
3WTV 2.7 Å, Crystal structure of the complex comprised of ETS1(V170G), RUNX1, CBFBETA, and the…
3WTY 2.7 Å, Crystal structure of the complex comprised of ETS1(G333P), RUNX1, CBFBETA, and the…

Browse structure collections

About this viewer

MolViewer shows 3WU1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.