3ZUO: OMCI

OMCI in complex with leukotriene B4. Determined by X-ray diffraction at 1.86 Å resolution. Released 1 Aug 2012.

Method: X-ray diffraction
Resolution: 1.86 Å
Organism: ORNITHODOROS MOUBATA
Chains: 4
Atoms: 4,977
Mol. weight: 68.56 kDa
Ligands: LTB
Released: 1 Aug 2012

Explore 3ZUO in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3ZUO contains 20 α-helices and 39 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	32-35	4
α-helix	37-39	3
β-strand	43-48	6	1
α-helix	53-54	2
β-strand	55-61	7	1
β-strand	70-77	8	1
β-strand	82-92	11	1
β-strand	95-100	6	1
β-strand	103-112	10	1
β-strand	118-124	7	1
β-strand	129-135	7	1
α-helix	141-155	15
β-strand	161	1	1
α-helix	163-165	3

Chains B and D: 5 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	32-35	4
α-helix	37-39	3
β-strand	43-48	6	2
α-helix	53-54	2
β-strand	55-61	7	2
β-strand	66	1	2
β-strand	69-77	9	2
β-strand	82-92	11	2
β-strand	95-100	6	2
β-strand	103-112	10	2
β-strand	118-124	7	2
β-strand	129-135	7	2
α-helix	141-154	14
β-strand	161	1	2
α-helix	163-165	3

Chain C: 5 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	32-35	4
α-helix	37-39	3
β-strand	43-48	6	3
α-helix	53-54	2
β-strand	55-61	7	3
β-strand	66	1	3
β-strand	69-77	9	3
β-strand	82-92	11	3
β-strand	95-100	6	3
β-strand	103-112	10	3
β-strand	118-124	7	3
β-strand	129-135	7	3
α-helix	141-155	15
β-strand	161	1	3
α-helix	163-165	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Complement inhibitor	A, B, C, D	protein	150	ORNITHODOROS MOUBATA	Q5YD59 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>3ZUO_1 COMPLEMENT INHIBITOR (chains A, B, C, D)
DSESDCTGSEPVDAFQAFSEGKEAYVLVRSTDPKARDCLKGEPAGEKQDNTLPVMMTFKN
GTDWASTDWTFTLDGAKVTATLGNLTQNREVVYDSQSHHCHVDKVEKEVPDYEMWMLDAG
GLEVEVECCRQKLEELASGRNQMYPHLKDC

Ligands and cofactors

ID	Name	Formula	Copies
LTB	Leukotriene B4	C20 H32 O4	4

Primary citation

Bifunctional Lipocalin Ameliorates Murine Immune Complex-Induced Acute Lung Injury. Roversi, P., Ryffel, B., Togbe, D. et al. J Biol Chem (2013) 288:18789. DOI 10.1074/JBC.M112.420331 · PubMed

Other PDB entries of the same protein (UniProt Q5YD59 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3ZUI 1.71 Å, OMCI in complex with palmitoleic acid
2CM4 1.9 Å, The complement inhibitor OmCI in complex with ricinoleic acid
2CM9 2.3 Å, The complement inhibitor OmCI in complex with ricinoleic acid
5HCC 2.59 Å, Ternary complex of human Complement C5 with Ornithodoros moubata OmCI and Dermacentor…
5HCD 2.98 Å, Ternary complex of human Complement C5 with Ornithodoros moubata OmCI and Rhipicephalus…
5HCE 3.12 Å, Ternary complex of human Complement C5 with Ornithodoros moubata OmCI and Rhipicephalus…
6RQJ 3.5 Å, Structure of human complement C5 complexed with tick inhibitors OmCI, RaCI1 and CirpT1

Browse structure collections

About this viewer

MolViewer shows 3ZUO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.