4AIF: AIP TPR domain

AIP TPR domain in complex with human Hsp90 peptide. Determined by X-ray diffraction at 2.01 Å resolution. Released 23 Jan 2013.

Method: X-ray diffraction
Resolution: 2.01 Å
Organism: HOMO SAPIENS
Chains: 4
Atoms: 2,706
Mol. weight: 34.73 kDa
Released: 23 Jan 2013

Explore 4AIF in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4AIF contains 17 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	178-192	15
α-helix	195-214	20
α-helix	221-243	23
α-helix	248-260	13
α-helix	265-277	13
α-helix	281-294	14
α-helix	296-298	3
α-helix	299-313	15

Chain B: 9 helices, 0 β-strands

Element	Residues	Length
α-helix	174-176	3
α-helix	178-191	14
α-helix	195-213	19
α-helix	221-243	23
α-helix	247-260	14
α-helix	265-277	13
α-helix	281-294	14
α-helix	296-298	3
α-helix	299-311	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ah receptor-interacting protein	A, B	protein	144	HOMO SAPIENS	O00170 (AlphaFold model)
Heat shock protein hsp 90-alpha	D, E	protein	7	HOMO SAPIENS	P07900 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4AIF_1 AH RECEPTOR-INTERACTING PROTEIN (chains A, B)
AEEKAKAVPLIHQEGNRLYREGHVKEAAAKYYDAIACLKNLQMKEQPGSPEWIQLDQQIT
PLLLNYCQCKLVVEEYYEVLDHCSSILNKYDDNVKAYFKRGKAHAAVWNAQEAQADFAKV
LELDPALAPVVSRELQALEARIRQ

Sequence of entity 2 (D, E), FASTA

>4AIF_2 HEAT SHOCK PROTEIN HSP 90-ALPHA (chains D, E)
SRMEEVD

Primary citation

Structure of the Tpr Domain of Aip: Lack of Client Protein Interaction with the C-Terminal Alpha-7 Helix of the Tpr Domain of Aip is Sufficient for Pituitary Adenoma Predisposition. Morgan, R.M., Hernandez-Ramirez, L.C., Trivellin, G. et al. PLoS One (2012) 7:53339. DOI 10.1371/JOURNAL.PONE.0053339 · PubMed

Other PDB entries of the same protein (UniProt O00170 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4APO 1.9 Å, AIP TPR domain in complex with human Tomm20 peptide
8QMO 2.76 Å, Cryo-EM structure of the benzo[a]pyrene-bound Hsp90-XAP2-AHR complex
7ZUB 2.85 Å, Cryo-EM structure of the indirubin-bound Hsp90-XAP2-AHR complex
2LKN Solution structure of the PPIase domain of human aryl-hydrocarbon receptor-interacting…

Browse structure collections

About this viewer

MolViewer shows 4AIF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.