4ARN: N-terminal domain of Drosophila Toll receptor

Crystal structure of the N-terminal domain of Drosophila Toll receptor. Determined by X-ray diffraction at 2.41 Å resolution. Released 23 Jan 2013.

Method: X-ray diffraction
Resolution: 2.41 Å
Organisms: DROSOPHILA MELANOGASTER, EPTATRETUS BURGERI
Chains: 4
Atoms: 9,283
Mol. weight: 131.56 kDa
Ligands: MLI, NAG
Released: 23 Jan 2013

Explore 4ARN in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4ARN contains 33 α-helices and 72 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 18 β-strands

Element	Residues	Length	Sheet
α-helix	31-40	10
β-strand	44-48	5	1
β-strand	51-56	6	1
β-strand	65-70	6	1
β-strand	74-79	6	1
α-helix	84-89	6
α-helix	91	1
β-strand	97-98	2	2
β-strand	101-105	5	1
α-helix	107-109	3
α-helix	116-121	6
β-strand	124-125	2	2
β-strand	129-133	5	1
α-helix	143-146	4
β-strand	154-158	5	1
β-strand	178-182	5	1
β-strand	201-203	3	1
β-strand	225-227	3	1
β-strand	249-251	3	1
β-strand	257	1	3
α-helix	265-273	9
β-strand	278-279	2	1
β-strand	283	1	4
β-strand	284	1	3
β-strand	290	1	4
α-helix	291-293	3
α-helix	296-298	3

Chain B: 9 helices, 18 β-strands

Element	Residues	Length	Sheet
α-helix	31-36	6
α-helix	37-39	3
β-strand	44-48	5	5
β-strand	51-56	6	5
β-strand	65-70	6	5
β-strand	74-79	6	5
α-helix	84-89	6
β-strand	97-98	2	6
β-strand	101-105	5	5
α-helix	107-109	3
α-helix	116-121	6
β-strand	124-125	2	6
β-strand	129-133	5	5
α-helix	143-146	4
β-strand	154-158	5	5
α-helix	164-166	3
β-strand	178-182	5	5
β-strand	201-203	3	5
β-strand	225-227	3	5
β-strand	249-251	3	5
β-strand	257	1	7
α-helix	265-273	9
β-strand	278-279	2	5
β-strand	283	1	8
β-strand	284	1	7
β-strand	290	1	8
α-helix	291-293	3

Chain C: 7 helices, 18 β-strands

Element	Residues	Length	Sheet
α-helix	31-35	5
β-strand	44-48	5	9
β-strand	51-56	6	9
β-strand	65-70	6	9
β-strand	74-79	6	9
α-helix	84-89	6
β-strand	97-98	2	10
β-strand	101-105	5	9
α-helix	107-109	3
α-helix	116-121	6
β-strand	124-125	2	10
β-strand	129-133	5	9
α-helix	144-146	3
β-strand	154-158	5	9
β-strand	178-182	5	9
β-strand	201-203	3	9
β-strand	225-227	3	9
β-strand	249-251	3	9
β-strand	257	1	11
α-helix	265-273	9
β-strand	278-279	2	9
β-strand	283	1	12
β-strand	284	1	11
β-strand	290	1	12
α-helix	291-293	3

Chain D: 8 helices, 18 β-strands

Element	Residues	Length	Sheet
α-helix	31-35	5
α-helix	37-40	4
β-strand	44-48	5	13
β-strand	51-56	6	13
β-strand	65-70	6	13
β-strand	74-79	6	13
α-helix	84-89	6
β-strand	97-98	2	14
β-strand	101-105	5	13
α-helix	107-109	3
α-helix	116-121	6
β-strand	124-125	2	14
β-strand	129-133	5	13
α-helix	144-146	3
β-strand	154-158	5	13
β-strand	178-182	5	13
β-strand	201-203	3	13
β-strand	225-227	3	13
β-strand	249-251	3	13
β-strand	257	1	15
α-helix	265-273	9
β-strand	278-279	2	13
β-strand	283	1	16
β-strand	284	1	15
β-strand	290	1	16
α-helix	291-293	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Toll receptor, variable lymphocyte receptor B.61 chimera	A, B, C, D	protein	279	DROSOPHILA MELANOGASTER, EPTATRETUS BURGERI	P08953 (AlphaFold model), Q4G1L2 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>4ARN_1 TOLL RECEPTOR, VARIABLE LYMPHOCYTE RECEPTOR B.61 CHIMERA (chains A, B, C, D)
SFGRDACSEMSIDGLCQCAPIMSEYEIICPANAENPTFRLTIQPKDYVQIMCNLTDTTDY
QQLPKKLRIGEVDRVQMRRCMLPGHTPIASILDYLGIVSPTTLIFESDNLGMNITRQHLD
RLHGLKRFRFTTRRLTHIPANLLTDMRNLSHLELRANIEEMPSHLFDDLENLESIEFGSN
KLRQMPRGIFGKMPKLKQLNLASNQLKSVPDGIFDRLTSLQKIWLHTNPWDCSCPRIDYL
SRWLNKNSQKEQGSAKCSGSGKPVRSIICPTTGENLYFQ

Ligands and cofactors

ID	Name	Formula	Copies
MLI	Malonate ion	C3 H2 O4	2
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	5

Primary citation

Functional Insights from the Crystal Structure of the N-Terminal Domain of the Prototypical Toll Receptor. Gangloff, M., Arnot, C.J., Lewis, M. et al. Structure (2013) 21:143. DOI 10.1016/J.STR.2012.11.003 · PubMed

Other PDB entries of the same protein (UniProt P08953 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4LXR 2.2 Å, Structure of the Toll - Spatzle complex, a molecular hub in Drosophila development and…
4BV4 2.35 Å, Structure and allostery in Toll-Spatzle recognition
4ARR 3.0 Å, Crystal structure of the N-terminal domain of Drosophila Toll receptor with the magic…
4LXS 3.3 Å, Structure of the Toll - Spatzle complex, a molecular hub in Drosophila development and…

Browse structure collections

About this viewer

MolViewer shows 4ARN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.