4ASH: NS6 protease from murine norovirus 1

Crystal structure of the NS6 protease from murine norovirus 1. Determined by X-ray diffraction at 1.58 Å resolution. Released 16 May 2012.

Method: X-ray diffraction
Resolution: 1.58 Å
Organism: MURINE NOROVIRUS 1
Chains: 2
Atoms: 2,901
Mol. weight: 38.74 kDa
Released: 16 May 2012

Explore 4ASH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4ASH contains 10 α-helices and 29 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	3-8	6
β-strand	9-12	4	1
β-strand	15-19	5	1
β-strand	24-28	5	1
α-helix	29-31	3
α-helix	33-34	2
β-strand	39	1	2
β-strand	42	1	2
β-strand	47-52	6	1
β-strand	55-60	6	1
β-strand	72-73	2	3
β-strand	82-88	7	3
β-strand	94-109	16	3
β-strand	112-121	10	3
α-helix	141	1
β-strand	142-147	6	3
β-strand	150-160	11	3
β-strand	166-170	5	3

Chain B: 6 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	4-8	5
β-strand	9-12	4	4
β-strand	15-19	5	4
β-strand	24-28	5	4
α-helix	29-31	3
α-helix	33-34	2
β-strand	39	1	5
β-strand	42	1	5
β-strand	44	1	4
β-strand	47-52	6	4
β-strand	55-60	6	4
α-helix	69-70	2
β-strand	72-73	2	6
β-strand	82-88	7	6
β-strand	94-109	16	6
β-strand	112-121	10	6
α-helix	141	1
β-strand	142-146	5	6
β-strand	151-160	10	6
β-strand	166-170	5	6
α-helix	175-178	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
NS6 protease	A, B	protein	185	MURINE NOROVIRUS 1	Q80J95 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4ASH_1 NS6 PROTEASE (chains A, B)
GSAPVSIWSRVVQFGTGWGFWVSGHVFITAKHVAPPKGTEIFGRKPGDFTVTSSGDFLKY
YFTSAVRPDIPAMVLENGCQEGVVASVLVKRASGEMLALAVRMGSQAAIKIGSAVVHGQT
GMLLTGSNAKAQDLGTIPGDAGCPYVYKKGNTWVVIGVHVAATRSGNTVIAATHGEPTLE
ALEFQ

Primary citation

Structure of a Murine Norovirus Ns6 Protease-Product Complex Revealed by Adventitious Crystallisation. Leen, E.N., Baeza, G., Curry, S. PLoS One (2012) 7:38723. DOI 10.1371/JOURNAL.PONE.0038723 · PubMed

Other PDB entries of the same protein (UniProt Q80J95 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3UQS 2.0 Å, Crystal structures of murine norovirus RNA-dependent RNA polymerase
3SFG 2.21 Å, crystal structure of murine norovirus RNA dependent RNA polymerase in complex with…
4NRU 2.3 Å, Murine Norovirus RNA-dependent-RNA-polymerase in complex with Compound 6, a suramin…
4X2V 2.3 Å, Crystal structure of the Murine Norovirus NS6 protease (inactive C139A mutant) with a…
8A8X 2.37 Å, TRIM7 PRYSPRY in complex with a MNV1-NS3 peptide HDDFGLQ
4O4R 2.4 Å, Murine Norovirus RdRp in complex with PPNDS
4X2Y 2.42 Å, Crystal structure of a chimeric Murine Norovirus NS6 protease (inactive C139A mutant) in…
3UR0 2.45 Å, Crystal structures of murine norovirus RNA-dependent RNA polymerase in complex with…
4X2X 2.47 Å, Crystal structure of the Murine Norovirus NS6 protease (inactive C139A mutant) with a…
3QID 2.5 Å, Crystal structures and functional analysis of murine norovirus RNA-dependent RNA…
3SFU 2.5 Å, crystal structure of murine norovirus RNA dependent RNA polymerase in complex with…
3NAI 2.56 Å, Crystal structures and functional analysis of murine norovirus RNA-dependent RNA…

Browse structure collections

About this viewer

MolViewer shows 4ASH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.