4ASV: N-terminal dimerisation domain of Sgt2

Solution structure of the N-terminal dimerisation domain of Sgt2. Determined by solution NMR. Released 16 Jan 2013.

Method: Solution NMR
Organism: SACCHAROMYCES CEREVISIAE
Chains: 2
Atoms: 1,188
Mol. weight: 20.2 kDa
Released: 16 Jan 2013

Explore 4ASV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4ASV contains 10 α-helices and 4 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 5 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	19-35	17
α-helix	41-58	18
α-helix	62-64	3
α-helix	65-71	7
β-strand	74	1	1
α-helix	79-84	6
β-strand	88	1	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Small glutamine-rich tetratricopeptide repeat-containing protein 2	A, B	protein	92	SACCHAROMYCES CEREVISIAE	Q12118 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4ASV_1 SMALL GLUTAMINE-RICH TETRATRICOPEPTIDE REPEAT-CONTAINING PROTEIN 2 (chains A, B)
MAHHHHHHVDDDDMMSASKEEIAALIVNYFSSIVEKKEISEDGADSLNVAMDCISEAFGF
EREAVSGILGKSEFKGQHLADILNSASRVPES

Primary citation

Structure of the Sgt2/Get5 Complex Provides Insights Into Get-Mediated Targeting of Tail-Anchored Membrane Proteins. Simon, A.C., Simpson, P.J., Goldstone, R.M. et al. Proc Natl Acad Sci U S A (2013) 110:1327. DOI 10.1073/PNAS.1207518110 · PubMed

Other PDB entries of the same protein (UniProt Q12118 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5LYP 1.55 Å, Crystal structure of the Tpr Domain of Sgt2.
3ZDM 1.8 Å, Crystal structure of the Sgt2 N domain and the Get5 UBL domain complex
5LYN 2.0 Å, Structure of the Tpr Domain of Sgt2 in complex with yeast Ssa1 peptide fragment
2LXB Solution structure of the Sgt2 homodimerization domain
2LXC Solution structure of the complex between the Sgt2 homodimerization domain and the Get5…
4ASW Structure of the complex between the N-terminal dimerisation domain of Sgt2 and the UBL…
9LLV Dimer Sgt2 from S.cerevisiae

Browse structure collections

About this viewer

MolViewer shows 4ASV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.