5LYP: Tpr Domain of Sgt2

Name: PDB 5LYP: Crystal structure of the Tpr Domain of Sgt2.
Published: 2017-10-25
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: chaperone

Crystal structure of the Tpr Domain of Sgt2. Determined by X-ray diffraction at 1.55 Å resolution. Released 25 Oct 2017.

Method: X-ray diffraction
Resolution: 1.55 Å
Organism: Saccharomyces cerevisiae
Chains: 1
Atoms: 1,157
Mol. weight: 15.72 kDa
Ligands: BO4
Released: 25 Oct 2017

Explore 5LYP in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5LYP contains 8 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	96-114	19
α-helix	118-131	14
α-helix	136-148	13
α-helix	152-165	14
α-helix	170-182	13
α-helix	186-200	15
α-helix	201-203	3
α-helix	206-224	19

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Small glutamine-rich tetratricopeptide repeat-containing protein 2	A	protein	140	Saccharomyces cerevisiae	Q12118 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5LYP_1 Small glutamine-rich tetratricopeptide repeat-containing protein 2 (chains A)
GSMEDDAETKAKAEDLKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSL
KEYDQAVKDAESAISIDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNATEAMK
RDYESAKKKVEQSLNLEKTV

Ligands and cofactors

ID	Name	Formula	Copies
BO4	Borate ion	B H4 O4	1

Primary citation

Structure and Interactions of the TPR Domain of Sgt2 with Yeast Chaperones and Ybr137wp. Krysztofinska, E.M., Evans, N.J., Thapaliya, A. et al. Front Mol Biosci (2017) 4:68-68. DOI 10.3389/fmolb.2017.00068 · PubMed

Other PDB entries of the same protein (UniProt Q12118 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3ZDM 1.8 Å, Crystal structure of the Sgt2 N domain and the Get5 UBL domain complex
5LYN 2.0 Å, Structure of the Tpr Domain of Sgt2 in complex with yeast Ssa1 peptide fragment
2LXB Solution structure of the Sgt2 homodimerization domain
2LXC Solution structure of the complex between the Sgt2 homodimerization domain and the Get5…
4ASV Solution structure of the N-terminal dimerisation domain of Sgt2
4ASW Structure of the complex between the N-terminal dimerisation domain of Sgt2 and the UBL…
9LLV Dimer Sgt2 from S.cerevisiae

Browse structure collections

About this viewer

MolViewer shows 5LYP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.