9LLV: Dimer Sgt2 from S.cerevisiae

Dimer Sgt2 from S.cerevisiae. Determined by solution NMR. Released 10 Dec 2025.

Method: Solution NMR
Organism: Saccharomyces cerevisiae S288C
Chains: 2
Atoms: 5,230
Mol. weight: 74.84 kDa
Released: 10 Dec 2025

Explore 9LLV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9LLV contains 29 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 14 helices, 0 β-strands

Element	Residues	Length
α-helix	5-22	18
α-helix	27-44	18
α-helix	51-57	7
α-helix	98-114	17
α-helix	118-131	14
α-helix	136-148	13
α-helix	152-165	14
α-helix	170-181	12
α-helix	187-200	14
α-helix	201-203	3
α-helix	206-222	17
α-helix	236-238	3
α-helix	271-274	4
α-helix	312-315	4

Chain B: 15 helices, 0 β-strands

Element	Residues	Length
α-helix	7-22	16
α-helix	27-44	18
α-helix	52-55	4
α-helix	91-93	3
α-helix	95-97	3
α-helix	98-113	16
α-helix	118-129	12
α-helix	136-148	13
α-helix	152-165	14
α-helix	170-183	14
α-helix	186-195	10
α-helix	196-200	5
α-helix	206-222	17
α-helix	253-256	4
α-helix	310-315	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Small glutamine-rich tetratricopeptide repeat-containing protein 2	A, B	protein	347	Saccharomyces cerevisiae S288C	Q12118 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>9LLV_1 Small glutamine-rich tetratricopeptide repeat-containing protein 2 (chains A, B)
MSASKEEIAALIVNYFSSIVEKKEISEDGADSLNVAMDCISEAFGFEREAVSGILGKSEF
KGQHLADILNSASRVPESNKKDDAENVEINIPEDDAETKAKAEDLKMQGNKAMANKDYEL
AINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAISIDPSYFRGYSRLGFAK
YAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKTVPEQSRDADVDA
SQGASAGGLPDLGSLLGGGLGGLMNNPQLMQAAQKMMSNPGAMQNIQKMMQDPSIRQMAE
GFASGGGTPNLSDLMNNPALRNMAGNLFGGAGAQSTDETPDNENKQY

Primary citation

Remote on-off switching of protein activity by intrinsically disordered region. Ji, T., Ge, P., Zhang, S. et al. Nat Struct Mol Biol (2025) 32:2088-2098. DOI 10.1038/s41594-025-01585-7 · PubMed

Other PDB entries of the same protein (UniProt Q12118 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5LYP 1.55 Å, Crystal structure of the Tpr Domain of Sgt2.
3ZDM 1.8 Å, Crystal structure of the Sgt2 N domain and the Get5 UBL domain complex
5LYN 2.0 Å, Structure of the Tpr Domain of Sgt2 in complex with yeast Ssa1 peptide fragment
2LXB Solution structure of the Sgt2 homodimerization domain
2LXC Solution structure of the complex between the Sgt2 homodimerization domain and the Get5…
4ASV Solution structure of the N-terminal dimerisation domain of Sgt2
4ASW Structure of the complex between the N-terminal dimerisation domain of Sgt2 and the UBL…

Browse structure collections

About this viewer

MolViewer shows 9LLV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.