4B60: RFnBPA(189-505)

Structure of rFnBPA(189-505) in complex with fibrinogen gamma chain C- terminal peptide. Determined by X-ray diffraction at 1.83 Å resolution. Released 9 Oct 2013.

Method: X-ray diffraction
Resolution: 1.83 Å
Organisms: STAPHYLOCOCCUS AUREUS SUBSP. AUREUS NCTC 8325, HOMO SAPIENS
Chains: 4
Atoms: 5,204
Mol. weight: 74.93 kDa
Ligands: CA
Released: 9 Oct 2013

Explore 4B60 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4B60 contains 15 α-helices and 56 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 27 β-strands

Element	Residues	Length	Sheet
β-strand	196	1	1
α-helix	198-200	3
β-strand	201-209	9	2
α-helix	211-213	3
β-strand	216-217	2	1
β-strand	221	1	3
β-strand	225-233	9	2
β-strand	242-247	6	1
β-strand	251-252	2	4
β-strand	255	1	3
β-strand	257	1	5
α-helix	263-264	2
β-strand	265-267	3	1
β-strand	270-277	8	1
β-strand	282-287	6	1
α-helix	289-291	3
β-strand	298-305	8	2
β-strand	306-307	2	4
β-strand	316-324	9	1
β-strand	327-335	9	1
β-strand	341-342	2	5
β-strand	346-356	11	5
β-strand	361-370	10	5
β-strand	375-386	12	3
α-helix	393-395	3
β-strand	396-402	7	5
α-helix	406-408	3
β-strand	423-425	3	5
α-helix	427-429	3
β-strand	434-436	3	3
β-strand	442-448	7	3
β-strand	453-460	8	5
β-strand	469-478	10	3
β-strand	490-501	12	3

Chain B: 8 helices, 27 β-strands

Element	Residues	Length	Sheet
β-strand	196	1	6
α-helix	198-200	3
β-strand	201-209	9	7
α-helix	211-213	3
β-strand	216-217	2	6
β-strand	221	1	8
β-strand	225-233	9	7
β-strand	242-247	6	6
β-strand	251-252	2	9
β-strand	255	1	8
β-strand	257	1	10
α-helix	263-264	2
β-strand	265-267	3	6
β-strand	270-277	8	6
α-helix	279-281	3
β-strand	282-287	6	6
α-helix	289-291	3
β-strand	298-305	8	7
β-strand	306-307	2	9
β-strand	316-324	9	6
β-strand	327-335	9	6
β-strand	341-342	2	10
β-strand	346-356	11	10
β-strand	361-370	10	10
β-strand	378-386	9	8
α-helix	393-395	3
β-strand	396-402	7	10
α-helix	406-408	3
β-strand	423-425	3	10
α-helix	427-429	3
β-strand	434-436	3	8
β-strand	442-446	5	8
β-strand	453-460	8	10
β-strand	469-475	7	8
β-strand	491-500	10	8

Chain C: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	6-16	11	3

Chain D: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	7-15	9	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Fibronectin-binding protein A	A, B	protein	321	STAPHYLOCOCCUS AUREUS SUBSP. AUREUS NCTC 8325	P14738 (AlphaFold model)
Fibrinogen gamma chain	C, D	protein	17	HOMO SAPIENS	P02679 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4B60_1 FIBRONECTIN-BINDING PROTEIN A (chains A, B)
GPAMAKVETGTDVTSKVTVEIGSIEGHNNTNKVEPHAGQRAVLKYKLKFENGLHQGDYFD
FTLSNNVNTHGVSTARKVPEIKNGSVVMATGEVLEGGKIRYTFTNDIEDKVDVTAELEIN
LFIDPKTVQTNGNQTITSTLNEEQTSKELDVKYKDGIGNYYANLNGSIETFNKANNRFSH
VAFIKPNNGKTTSVTVTGTLMKGSNQNGNQPKVRIFEYLGNNEDIAKSVYANTTDTSKFK
EVTSNMSGNLNLQNNGSYSLNIENLDKTYVVHYDGEYLNGTDEVDFRTQMVGHPEQLYKY
YYDRGYTLTWDNGLVLYSNKA

Sequence of entity 2 (C, D), FASTA

>4B60_2 FIBRINOGEN GAMMA CHAIN (chains C, D)
GEGQQHHLGGAKQAGDV

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	1

Primary citation

Evidence for Steric Regulation of Fibrinogen Binding to Staphylococcus Aureus Fibronectin-Binding Protein a (Fnbpa). Stemberk, V., Jones, R.P., Moroz, O. et al. J Biol Chem (2014) 289:12842. DOI 10.1074/JBC.M113.543546 · PubMed

Other PDB entries of the same protein (UniProt P14738 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3CAL 1.7 Å, Crystal structure of the second and third fibronectin F1 modules in complex with a…
2RKY 1.8 Å, Crystal structure of the fourth and fifth fibronectin F1 modules in complex with a…
2RKZ 2.0 Å, Crystal structure of the second and third fibronectin f1 modules in complex with a…
2RL0 2.0 Å, Crystal structure of the fourth and fifth fibronectin F1 modules in complex with a…
4B5Z 2.2 Å, Structure of the apo-rFnBPA(189-505) from Staphylococcus aureus

Browse structure collections

About this viewer

MolViewer shows 4B60 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.