4BA9: DNA polymerase kappa, DNA repair protein REV1

The structural basis for the coordination of Y-family Translesion DNA Polymerases by Rev1. Determined by X-ray diffraction at 2.73 Å resolution. Released 25 Sept 2013.

Method: X-ray diffraction
Resolution: 2.73 Å
Organism: HOMO SAPIENS
Chains: 6
Atoms: 5,313
Mol. weight: 79.03 kDa
Ligands: NI, MG
Released: 25 Sept 2013

Explore 4BA9 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4BA9 contains 30 α-helices and 12 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, D and E: 5 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	209-216	8
β-strand	1159	1	1
β-strand	1162	1	1
α-helix	1165-1178	14
α-helix	1184-1199	16
α-helix	1203-1219	17
α-helix	1223-1241	19

Chains B and F: 5 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	209-215	7
β-strand	1159	1	2
β-strand	1162	1	2
α-helix	1165-1178	14
α-helix	1184-1199	16
α-helix	1203-1219	17
α-helix	1223-1241	19

Chain C: 5 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	209-216	8
β-strand	1159	1	3
β-strand	1162	1	3
α-helix	1165-1178	14
α-helix	1184-1199	16
α-helix	1203-1218	16
α-helix	1223-1241	19

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA polymerase kappa, DNA repair protein REV1	A, B, C, D, E, F	protein	114	HOMO SAPIENS	Q9UBT6 (AlphaFold model), Q9UBZ9 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F), FASTA

>4BA9_1 DNA POLYMERASE KAPPA, DNA REPAIR PROTEIN REV1 (chains A, B, C, D, E, F)
GPHMHKKSFFDKKRSERGSDAGSAGDGASNLAGAVEFNDVKTLLREWITTISDPMEEDIL
QVVKYCTDLIEEKDLEKLDLVIKYMKRLMQQSVESVWNMAFDFILDNVQVVLQQ

Ligands and cofactors

ID	Name	Formula	Copies
NI	Nickel (II) ion	Ni	10
MG	Magnesium ion	Mg	8

Primary citation

The Structural Basis for the Coordination of Y- Family Translesion DNA Polymerases by Rev1. Grummitt, C.G., Kilkenny, M.L., Frey, A. et al. To be published.

Other PDB entries of the same protein (UniProt Q9UBT6 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6CST 2.0 Å, Structure of human DNA polymerase kappa with DNA
1T94 2.4 Å, Crystal structure of the catalytic core of human DNA polymerase kappa
5W2C 2.5 Å, Structure of human DNA polymerase kappa in complex with Lucidin-derived DNA adduct and…
4U6P 2.59 Å, Structural mechanism of error-free bypass of major benzo[a]pyrene adduct by human…
4U7C 2.8 Å, Structure of DNA polymerase kappa in complex with benzopyrene adducted DNA
6BRX 2.8 Å, Crystal Structure of Human DNA polymerase kappa in complex with DNA containing the major…
5W2A 2.9 Å, Structure of human DNA polymerase kappa in complex with Lucidin-derived DNA adduct and…
5T14 3.0 Å, DNA polymerase kappa extending beyond a bulky major benzo[a]pyrene adduct
2OH2 3.05 Å, Ternary Complex of Human DNA Polymerase
6BS1 3.15 Å, Crystal Structure of Human DNA polymerase kappa in complex with DNA containing the major…
2W7O 3.16 Å, Structure and Activity of Bypass Synthesis by Human DNA Polymerase Kappa Opposite the…
3IN5 3.2 Å, Structure of human DNA polymerase kappa inserting dATP opposite an 8-oxoG DNA lesion

Browse structure collections

About this viewer

MolViewer shows 4BA9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.