4BKG: Human diSUMO-2

crystal structure of human diSUMO-2. Determined by X-ray diffraction at 2.11 Å resolution. Released 6 Nov 2013.

Method: X-ray diffraction
Resolution: 2.11 Å
Organism: HOMO SAPIENS
Chains: 1
Atoms: 612
Mol. weight: 19.19 kDa
Released: 6 Nov 2013

Explore 4BKG in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4BKG contains 2 α-helices and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	18-23	6	1
β-strand	29-34	6	1
α-helix	41-51	11
α-helix	55-57	3
β-strand	58-62	5	1
β-strand	65-66	2	1
β-strand	82-88	7	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Small ubiquitin-related modifier 2	A	protein	168	HOMO SAPIENS	P61956 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4BKG_1 SMALL UBIQUITIN-RELATED MODIFIER 2 (chains A)
GSTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINE
TDTPAQLEMEDEDTIDVFQQQTGGRSTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMK
AYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGG

Primary citation

Multivalent Interactions of the Sumo-Interaction Motifs in the Ring-Finger Protein 4 (Rnf4) Determine the Specificity for Chains of the Small Ubiquitin-Related Modifier (Sumo). Keusekotten, K., Bade, V.N., Meyer-Teschendorf, K. et al. Biochem J (2014) 457:207. DOI 10.1042/BJ20130753 · PubMed

Other PDB entries of the same protein (UniProt P61956 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1WM3 1.2 Å, Crystal structure of human SUMO-2 protein
1WM2 1.6 Å, Crystal structure of human SUMO-2 protein
4NPN 1.63 Å, Crystal structure of human tetra-SUMO-2
7P99 1.8 Å, Structure of human USPL1 in complex with SUMO2
2D07 2.1 Å, Crystal Structure of SUMO-3-modified Thymine-DNA Glycosylase
3ZO5 2.15 Å, Structure of SENP2-Loop1 in complex with preSUMO-2
2IO0 2.3 Å, Crystal structure of human Senp2 in complex with preSUMO-2
5ELU 2.35 Å, Isoform-specific inhibition of SUMO-dependent protein-protein interactions
5D2M 2.4 Å, Complex between human SUMO2-RANGAP1, UBC9 and ZNF451
7ZJV 2.4 Å, Structure of human USPL1 in covalent complex with DeltaN-SUMO2/3-PA probe
5EQL 2.49 Å, Isoform-specific inhibition of SUMO-dependent protein-protein interactions
3UIN 2.6 Å, Complex between human RanGAP1-SUMO2, UBC9 and the IR1 domain from RanBP2

Browse structure collections

About this viewer

MolViewer shows 4BKG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.