4NPN: Human tetra-SUMO-2

Crystal structure of human tetra-SUMO-2. Determined by X-ray diffraction at 1.63 Å resolution. Released 15 Oct 2014.

Method: X-ray diffraction
Resolution: 1.63 Å
Organism: Homo sapiens
Chains: 1
Atoms: 604
Mol. weight: 11.46 kDa
Released: 15 Oct 2014

Explore 4NPN in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4NPN contains 2 α-helices and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	18-23	6	1
β-strand	29-34	6	1
α-helix	41-51	11
β-strand	60-62	3	1
β-strand	65-66	2	1
α-helix	67-68	2
β-strand	82-86	5	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Small ubiquitin-related modifier 2	A	protein	102	Homo sapiens	P61956 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4NPN_1 Small ubiquitin-related modifier 2 (chains A)
GSHMASMTGGQQMGRGSEFTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQG
LSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGL

Primary citation

Structural analysis of poly-SUMO chain recognition by the RNF4-SIMs domain. Kung, C.C.-H., Naik, M.T., Wang, S.H. et al. Biochem J (2014) 462:53-65. DOI 10.1042/BJ20140521 · PubMed

Other PDB entries of the same protein (UniProt P61956 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1WM3 1.2 Å, Crystal structure of human SUMO-2 protein
1WM2 1.6 Å, Crystal structure of human SUMO-2 protein
7P99 1.8 Å, Structure of human USPL1 in complex with SUMO2
2D07 2.1 Å, Crystal Structure of SUMO-3-modified Thymine-DNA Glycosylase
4BKG 2.11 Å, crystal structure of human diSUMO-2
3ZO5 2.15 Å, Structure of SENP2-Loop1 in complex with preSUMO-2
2IO0 2.3 Å, Crystal structure of human Senp2 in complex with preSUMO-2
5ELU 2.35 Å, Isoform-specific inhibition of SUMO-dependent protein-protein interactions
5D2M 2.4 Å, Complex between human SUMO2-RANGAP1, UBC9 and ZNF451
7ZJV 2.4 Å, Structure of human USPL1 in covalent complex with DeltaN-SUMO2/3-PA probe
5EQL 2.49 Å, Isoform-specific inhibition of SUMO-dependent protein-protein interactions
3UIN 2.6 Å, Complex between human RanGAP1-SUMO2, UBC9 and the IR1 domain from RanBP2

Browse structure collections

About this viewer

MolViewer shows 4NPN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.