4BMD: S.pombe Rad4 BRCT3,4

Crystal structure of S.pombe Rad4 BRCT3,4. Determined by X-ray diffraction at 2.5 Å resolution. Released 9 Oct 2013.

Method: X-ray diffraction
Resolution: 2.5 Å
Organism: SCHIZOSACCHAROMYCES POMBE
Chains: 1
Atoms: 1,749
Mol. weight: 23.97 kDa
Released: 9 Oct 2013

Explore 4BMD in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4BMD contains 11 α-helices and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	307-310	4	1
α-helix	315-326	12
β-strand	331-332	2	1
β-strand	342-345	4	1
α-helix	351-353	3
β-strand	361-363	3	1
α-helix	364-372	9
α-helix	383-385	3
α-helix	391-393	3
α-helix	394-397	4
β-strand	401-405	5	2
α-helix	409-421	13
β-strand	425-427	3	2
β-strand	436-439	4	2
α-helix	444-446	3
α-helix	447-458	12
β-strand	462-465	4	2
α-helix	467-475	9
α-helix	483-485	3
β-strand	486	1	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
S-M checkpoint control protein RAD4	A	protein	204	SCHIZOSACCHAROMYCES POMBE	P32372 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4BMD_1 S-M CHECKPOINT CONTROL PROTEIN RAD4 (chains A)
DTELNIENEAKLFKNLTFYLYEFPNTKVSRLHKCLSDNGGQISEFLSSTIDFVVIPHYFP
VDELPIFSFPTVNEWWIERCLYYKKIFGIDEHALAKPFFRPSLVPYFNGLSIHLTGFKGE
ELSHLKKALTILGAVVHEFLGVQRSILLVNTNEPFSMKTRFKIQHATEWNVRVVGVAWLW
NIIQSGKFIDQVSPWAIDKKENQE

Primary citation

Phosphorylation-Dependent Assembly and Coordination of the DNA Damage Checkpoint Apparatus by Rad4(Topbp1.). Qu, M., Rappas, M., Wardlaw, C.P. et al. Mol Cell (2013) 51:723. DOI 10.1016/J.MOLCEL.2013.08.030 · PubMed

Other PDB entries of the same protein (UniProt P32372 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4BU0 1.5 Å, Crystal structure of Rad4 BRCT1,2 in complex with a Crb2 phosphopeptide
6HM4 1.77 Å, Crystal structure of Rad4 BRCT1,2 in complex with a Mdb1 phosphopeptide
6HM3 1.77 Å, Crystal structure of Rad4 BRCT1,2 in complex with a Sld3 phosphopeptide
4BMC 1.98 Å, Crystal structure of s.pombe Rad4 BRCT1,2
4BU1 2.1 Å, Crystal structure of Rad4 BRCT1,2 in complex with a Crb2 phosphopeptide

Browse structure collections

About this viewer

MolViewer shows 4BMD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.