6HM3: Rad4 BRCT1,2

Crystal structure of Rad4 BRCT1,2 in complex with a Sld3 phosphopeptide. Determined by X-ray diffraction at 1.77 Å resolution. Released 17 Oct 2018.

Method: X-ray diffraction
Resolution: 1.77 Å
Organisms: Schizosaccharomyces pombe (strain 972 / ATCC 24843), Schizosaccharomyces pombe
Chains: 2
Atoms: 1,907
Mol. weight: 24.91 kDa
Ligands: CA
Released: 17 Oct 2018

Explore 6HM3 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6HM3 contains 12 α-helices and 11 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	11-15	5	1
α-helix	19-31	13
β-strand	35-37	3	1
β-strand	40-41	2	2
β-strand	46-49	4	1
α-helix	55-63	9
β-strand	68-70	3	1
α-helix	74-83	10
α-helix	86-88	3
α-helix	95-97	3
β-strand	98	1	1
α-helix	99-100	2
β-strand	106-110	5	3
α-helix	116-126	11
β-strand	130-131	2	3
β-strand	141-144	4	3
α-helix	150-157	8
β-strand	161-163	3	3
α-helix	166-174	9
α-helix	177-179	3
α-helix	180-183	4

Chain B: 1 helix, 1 β-strand

Element	Residues	Length	Sheet
β-strand	631-633	3	2
α-helix	634-640	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
S-M checkpoint control protein rad4	A	protein	186	Schizosaccharomyces pombe (strain 972 / ATCC 24843)	P32372 (AlphaFold model)
DNA replication regulator sld3	B	protein	30	Schizosaccharomyces pombe	Q09761 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6HM3_1 S-M checkpoint control protein rad4 (chains A)
MGSSKPLKGFVICCTSIDLKQRTEISTKATKLGAAYRSDFTKDVTHLIAGDFDTPKYKFA
AKSRPDIKIMSSEWIPVLYESWVQGEDLDDGLLVDKHLLPTLFKCRVCLTNIGQPERSRI
ENYVLKHGGTFCPDLTRDVTHLIAGTSSGRKYEYALKWKINVVCVEWLWQSIQRNAVLEP
QYFQLD

Sequence of entity 2 (B), FASTA

>6HM3_2 DNA replication regulator sld3 (chains B)
GYDSILVQATPRKSSSVITELPDTPIKMNS

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	2

Water and common crystallization additives (GOL) are not listed.

Primary citation

BRCT domains of the DNA damage checkpoint proteins TOPBP1/Rad4 display distinct specificities for phosphopeptide ligands. Day, M., Rappas, M., Ptasinska, K. et al. Elife (2018) 7. DOI 10.7554/eLife.39979 · PubMed

Other PDB entries of the same protein (UniProt P32372 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4BU0 1.5 Å, Crystal structure of Rad4 BRCT1,2 in complex with a Crb2 phosphopeptide
6HM4 1.77 Å, Crystal structure of Rad4 BRCT1,2 in complex with a Mdb1 phosphopeptide
4BMC 1.98 Å, Crystal structure of s.pombe Rad4 BRCT1,2
4BU1 2.1 Å, Crystal structure of Rad4 BRCT1,2 in complex with a Crb2 phosphopeptide
4BMD 2.5 Å, Crystal structure of S.pombe Rad4 BRCT3,4

Browse structure collections

About this viewer

MolViewer shows 6HM3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.