4BU1: Rad4 BRCT1,2

Crystal structure of Rad4 BRCT1,2 in complex with a Crb2 phosphopeptide. Determined by X-ray diffraction at 2.1 Å resolution. Released 9 Oct 2013.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: SCHIZOSACCHAROMYCES POMBE
Chains: 4
Atoms: 3,613
Mol. weight: 47.15 kDa
Ligands: PO4
Released: 9 Oct 2013

Explore 4BU1 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4BU1 contains 25 α-helices and 22 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	11-15	5	1
α-helix	19-31	13
β-strand	35-37	3	1
β-strand	46-49	4	1
α-helix	55-63	9
β-strand	68-70	3	1
α-helix	74-83	10
α-helix	95-97	3
β-strand	98	1	1
α-helix	99-100	2
β-strand	106-110	5	2
α-helix	116-126	11
β-strand	130-131	2	2
β-strand	135-136	2	3
β-strand	141-144	4	2
α-helix	150-157	8
β-strand	161-163	3	2
α-helix	166-174	9
α-helix	177-179	3
α-helix	180-183	4

Chain B: 11 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	11-15	5	4
α-helix	19-31	13
α-helix	34	1
β-strand	35-37	3	4
β-strand	46-49	4	4
α-helix	55-63	9
β-strand	68-70	3	4
α-helix	74-83	10
α-helix	95-97	3
β-strand	98	1	4
α-helix	99-100	2
β-strand	106-110	5	5
α-helix	116-126	11
β-strand	130-131	2	5
β-strand	135-136	2	6
β-strand	141-144	4	5
α-helix	150-157	8
β-strand	161-163	3	5
α-helix	166-174	9
α-helix	177-179	3
α-helix	180-182	3

Chains C and D: 2 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	231-232	2	3
α-helix	233-236	4
α-helix	237-239	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
S-M checkpoint control protein RAD4	A, B	protein	186	SCHIZOSACCHAROMYCES POMBE	P32372 (AlphaFold model)
DNA repair protein RHP9	C, D	protein	14	SCHIZOSACCHAROMYCES POMBE	P87074 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4BU1_1 S-M CHECKPOINT CONTROL PROTEIN RAD4 (chains A, B)
MGSSKPLKGFVICCTSIDLKQRTEISTKATKLGAAYRSDFTKDVTHLIAGDFDTPKYKFA
AKSRPDIKIMSSEWIPVLYESWVQGEDLDDGLLVDKHLLPTLFKCRVCLTNIGQPERSRI
ENYVLKHGGTFCPDLTRDVTHLIAGTSSGRKYEYALKWKINVVCVEWLWQSIQRNAVLEP
QYFQLD

Sequence of entity 2 (C, D), FASTA

>4BU1_2 DNA REPAIR PROTEIN RHP9 (chains C, D)
GYGRVESTPPAFLP

Ligands and cofactors

ID	Name	Formula	Copies
PO4	Phosphate ion	O4 P	2

Water and common crystallization additives (EDO, 1PE, GOL) are not listed.

Primary citation

Phosphorylation-Dependent Assembly and Coordination of the DNA Damage Checkpoint Apparatus by Rad4(Topbp1.). Qu, M., Rappas, M., Wardlaw, C.P. et al. Mol Cell (2013) 51:723. DOI 10.1016/J.MOLCEL.2013.08.030 · PubMed

Other PDB entries of the same protein (UniProt P32372 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4BU0 1.5 Å, Crystal structure of Rad4 BRCT1,2 in complex with a Crb2 phosphopeptide
6HM4 1.77 Å, Crystal structure of Rad4 BRCT1,2 in complex with a Mdb1 phosphopeptide
6HM3 1.77 Å, Crystal structure of Rad4 BRCT1,2 in complex with a Sld3 phosphopeptide
4BMC 1.98 Å, Crystal structure of s.pombe Rad4 BRCT1,2
4BMD 2.5 Å, Crystal structure of S.pombe Rad4 BRCT3,4

Browse structure collections

About this viewer

MolViewer shows 4BU1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.