4BWS: Heterotrimer of PQBP1, U5-15kD and U5-52kD
Crystal structure of the heterotrimer of PQBP1, U5-15kD and U5-52kD. Determined by X-ray diffraction at 2.5 Å resolution. Released 30 Apr 2014.
- Method
- X-ray diffraction
- Resolution
- 2.5 Å
- Organism
- HOMO SAPIENS
- Chains
- 6
- Atoms
- 3,667
- Mol. weight
- 58.2 kDa
- Released
- 30 Apr 2014
Explore 4BWS in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
4BWS contains 20 α-helices and 24 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 4 helices, 8 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 7-8 | 2 | 1 |
| α-helix | 11-18 | 8 | |
| β-strand | 25-31 | 7 | 1 |
| α-helix | 36-52 | 17 | |
| β-strand | 56-62 | 7 | 1 |
| α-helix | 67-69 | 3 | |
| β-strand | 80-85 | 6 | 1 |
| β-strand | 88-90 | 3 | 1 |
| β-strand | 91-93 | 3 | 2 |
| β-strand | 102 | 1 | 1 |
| α-helix | 109-125 | 17 | |
| β-strand | 129-131 | 3 | 2 |
Chain B: 2 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 243-247 | 5 | |
| α-helix | 248-258 | 11 | |
Chain C: 4 helices, 4 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 279-281 | 3 | |
| β-strand | 282-286 | 5 | 3 |
| α-helix | 294-295 | 2 | |
| β-strand | 296-300 | 5 | 3 |
| α-helix | 301-308 | 8 | |
| β-strand | 318-321 | 4 | 3 |
| β-strand | 330-331 | 2 | 3 |
| α-helix | 337-339 | 3 | |
Chain D: 3 helices, 8 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 7-8 | 2 | 4 |
| α-helix | 11-19 | 9 | |
| β-strand | 25-31 | 7 | 4 |
| α-helix | 36-52 | 17 | |
| β-strand | 56-62 | 7 | 4 |
| β-strand | 80-85 | 6 | 4 |
| β-strand | 88-90 | 3 | 4 |
| β-strand | 91-93 | 3 | 5 |
| β-strand | 102 | 1 | 4 |
| α-helix | 109-125 | 17 | |
| β-strand | 129-131 | 3 | 5 |
Chain E: 2 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 244-247 | 4 | |
| α-helix | 248-259 | 12 | |
Chain F: 5 helices, 4 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 279-281 | 3 | |
| β-strand | 283-286 | 4 | 6 |
| α-helix | 294-295 | 2 | |
| β-strand | 296-299 | 4 | 6 |
| α-helix | 301-308 | 8 | |
| β-strand | 318-321 | 4 | 6 |
| α-helix | 327-329 | 3 | |
| β-strand | 330-331 | 2 | 6 |
| α-helix | 337-340 | 4 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Thioredoxin-like protein 4A | A, D | protein | 142 | HOMO SAPIENS | P83876 (AlphaFold model) |
| Polyglutamine-binding protein 1 | B, E | protein | 37 | HOMO SAPIENS | O60828 (AlphaFold model) |
| CD2 antigen cytoplasmic tail-binding protein 2 | C, F | protein | 71 | HOMO SAPIENS | O95400 (AlphaFold model) |
Sequence of entity 1 (A, D), FASTA
>4BWS_1 THIOREDOXIN-LIKE PROTEIN 4A (chains A, D)
MAHHHHHHMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNF
AVIYLVDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWAMEDKQEMVDI
IETVYRGARKGRGLVVSPKDYS
Sequence of entity 2 (B, E), FASTA
>4BWS_2 POLYGLUTAMINE-BINDING PROTEIN 1 (chains B, E)
TGADTTAAGPLFQQRPYPSPGAVLRANAEASRTKQQD
Sequence of entity 3 (C, F), FASTA
>4BWS_3 CD2 ANTIGEN CYTOPLASMIC TAIL-BINDING PROTEIN 2 (chains C, F)
MAHHHHHHMDVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFY
NSKRIDFDLYT
Primary citation
Mutations in the Pqbp1 Gene Prevent its Interaction with the Spliceosomal Protein U5-15Kd. Mizuguchi, M., Obita, T., Serita, T. et al. Nat Commun (2014) 5:3822. DOI 10.1038/NCOMMS4822 · PubMed
Other PDB entries of the same protein (UniProt P83876 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 1QGV 1.4 Å, Human spliceosomal protein U5-15KD
- 4BWQ 2.1 Å, Crystal structure of U5-15kD in a complex with PQBP1
- 1SYX 2.35 Å, The crystal structure of a binary U5 snRNP complex
- 4CDO 2.5 Å, Crystal structure of PQBP1 bound to spliceosomal U5-15kD
- 8H6L 2.6 Å, Cryo-EM structure of human exon-defined spliceosome in the early B state.
- 8H6K 2.7 Å, Cryo-EM structure of human exon-defined spliceosome in the mature B state.
- 6QW6 2.92 Å, Structure of the human U5.U4/U6 tri-snRNP at 2.9A resolution.
- 8Q7N 3.1 Å, cryo-EM structure of the human spliceosomal B complex protomer (tri-snRNP core region)
- 8QOZ 3.1 Å, Cryo-EM Structure of Pre-B+5'ss+ATPgammaS Complex (core part)
- 8QPE 3.1 Å, Cryo-EM Structure of Pre-B-like Complex (core part)
- 8H6E 3.2 Å, Cryo-EM structure of human exon-defined spliceosome in the late pre-B state.
- 8H6J 3.25 Å, Cryo-EM structure of human exon-defined spliceosome in the mature pre-B state.
Browse structure collections
About this viewer
MolViewer shows 4BWS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.