Crystal structure of Plasmodium berghei actin II. Determined by X-ray diffraction at 2.2 Å resolution. Released 30 Apr 2014.
Explore 4CBX in 3D Show helices and sheets RCSB PDB PDBe
4CBX contains 31 α-helices and 28 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 6-7 | 2 | |
| β-strand | 8-12 | 5 | 1 |
| β-strand | 16-21 | 6 | 1 |
| β-strand | 29-32 | 4 | 1 |
| β-strand | 35-37 | 3 | 2 |
| β-strand | 53-54 | 2 | 2 |
| α-helix | 57-60 | 4 | |
| β-strand | 66-68 | 3 | 2 |
| β-strand | 71-72 | 2 | 3 |
| β-strand | 75-76 | 2 | 3 |
| α-helix | 79-87 | 9 | |
| α-helix | 88-94 | 7 | |
| α-helix | 98-100 | 3 | |
| β-strand | 103-107 | 5 | 1 |
| α-helix | 113-125 | 13 | |
| β-strand | 131-136 | 6 | 1 |
| α-helix | 137-144 | 8 | |
| β-strand | 150-155 | 6 | 4 |
| β-strand | 160-166 | 7 | 4 |
| β-strand | 169-170 | 2 | 4 |
| β-strand | 176-178 | 3 | 4 |
| α-helix | 182-194 | 13 | |
| α-helix | 203-216 | 14 | |
| β-strand | 218 | 1 | 5 |
| α-helix | 223-232 | 10 | |
| α-helix | 234-236 | 3 | |
| β-strand | 239-242 | 4 | 6 |
| β-strand | 248-251 | 4 | 6 |
| α-helix | 254-257 | 4 | |
| α-helix | 259-262 | 4 | |
| α-helix | 265-268 | 4 | |
| α-helix | 275-284 | 10 | |
| α-helix | 288-295 | 8 | |
| β-strand | 298-301 | 4 | 4 |
| α-helix | 303-305 | 3 | |
| β-strand | 308 | 1 | 5 |
| α-helix | 310-321 | 12 | |
| α-helix | 323 | 1 | |
| β-strand | 330-331 | 2 | 4 |
| α-helix | 336-338 | 3 | |
| α-helix | 339-347 | 9 | |
| α-helix | 351-353 | 3 | |
| β-strand | 358-359 | 2 | 1 |
| α-helix | 360-364 | 5 | |
| α-helix | 367-370 | 4 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 30-34 | 5 | |
| β-strand | 40-46 | 7 | 7 |
| β-strand | 51-53 | 3 | 7 |
| α-helix | 54-55 | 2 | |
| α-helix | 56-58 | 3 | |
| β-strand | 61-63 | 3 | 8 |
| β-strand | 67-75 | 9 | 7 |
| α-helix | 80 | 1 | |
| β-strand | 81-89 | 9 | 7 |
| α-helix | 95-111 | 17 | |
| β-strand | 116-122 | 7 | 7 |
| α-helix | 128-132 | 5 | |
| β-strand | 139-141 | 3 | 8 |
| α-helix | 146-147 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Actin-2 | A | protein | 378 | PLASMODIUM BERGHEI | Q4YU79 (AlphaFold model) |
| Gelsolin | G | protein | 127 | MUS MUSCULUS | P13020 (AlphaFold model) |
>4CBX_1 ACTIN-2 (chains A) GPMPEESIALVVDNGSGMVKSGLAGDDAPKCVFPSIIGIPKMPNIMVGMEQKECYVGDEA QNKRGILTLKYPIEHGIVTNWDDMEKIWRHTFFNELRVSPEEHPVLLTEAPLNPKTNREK MTQIMFESFDVPAMYVSIQAILSLYASGRTTGIVLDSGDGVTHTVPIYEGYVLPHAINRT DMAGRDLTYYMMKLFTERGYTFTTTAEREIVRDIKEKLCYIALDYDEELKKSEERTEEVE EMYELPDGNLITVGSERFRCPEALFNPSLIGRECPGLHITAYQSIMKCDIDIRKELYNNI VLSGGTTMYNYIGERLTNEMTSLAPPSMKIKVIAPPERKYSVWIGGSILSSLSTFQKMWI TKEEYDESGPSIVHRKCF
>4CBX_2 GELSOLIN (chains G) GPMVVEHPEFLKAGKEPGLQIWRVEKFDLVPVPPNLYGDFFTGDAYVILKTVQLRNGNLQ YDLHYWLGNECSQDESGAAAIFTVQLDDYLNGRAVQHREVQGFESSTFSGYFKSGLKYKK GGVASGF
| ID | Name | Formula | Copies |
|---|---|---|---|
| PO4 | Phosphate ion | O4 P | 1 |
| CA | Calcium ion | Ca | 3 |
| ATP | Adenosine-5'-triphosphate | C10 H16 N5 O13 P3 | 1 |
Water and common crystallization additives (NA, SO4) are not listed.
Structural Differences Explain Diverse Functions of Plasmodium Actins. Vahokoski, J., Bhargav, S.P., Desfosses, A. et al. PLoS Pathog (2014) 10:4091. DOI 10.1371/JOURNAL.PPAT.1004091 · PubMed
Other PDB entries of the same protein (UniProt Q4YU79 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4CBX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.