Crystal Structure of Plasmodium berghei actin II in the Mg-ADP state. Determined by X-ray diffraction at 1.87 Å resolution. Released 26 Jun 2019.
Explore 6I4M in 3D Show helices and sheets RCSB PDB PDBe
6I4M contains 32 α-helices and 26 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 8-12 | 5 | 1 |
| β-strand | 16-21 | 6 | 1 |
| β-strand | 29-32 | 4 | 1 |
| β-strand | 35-37 | 3 | 2 |
| β-strand | 53-54 | 2 | 2 |
| α-helix | 56-60 | 5 | |
| β-strand | 66-68 | 3 | 2 |
| α-helix | 79-87 | 9 | |
| α-helix | 88-94 | 7 | |
| α-helix | 98-100 | 3 | |
| β-strand | 103-107 | 5 | 1 |
| α-helix | 113-121 | 9 | |
| α-helix | 122-126 | 5 | |
| β-strand | 131-136 | 6 | 1 |
| α-helix | 137-144 | 8 | |
| β-strand | 150-155 | 6 | 3 |
| β-strand | 160-166 | 7 | 3 |
| β-strand | 169-170 | 2 | 3 |
| α-helix | 172-174 | 3 | |
| β-strand | 176-178 | 3 | 3 |
| α-helix | 182-194 | 13 | |
| α-helix | 203-216 | 14 | |
| β-strand | 218 | 1 | 4 |
| α-helix | 223-232 | 10 | |
| α-helix | 234-236 | 3 | |
| β-strand | 239-242 | 4 | 5 |
| β-strand | 248-251 | 4 | 5 |
| α-helix | 254-260 | 7 | |
| α-helix | 265-268 | 4 | |
| α-helix | 273-274 | 2 | |
| α-helix | 275-284 | 10 | |
| α-helix | 288-295 | 8 | |
| β-strand | 298-301 | 4 | 3 |
| α-helix | 303-305 | 3 | |
| β-strand | 308 | 1 | 4 |
| α-helix | 310-321 | 12 | |
| α-helix | 323 | 1 | |
| β-strand | 330-331 | 2 | 3 |
| α-helix | 336-338 | 3 | |
| α-helix | 339-349 | 11 | |
| α-helix | 351-353 | 3 | |
| β-strand | 358-359 | 2 | 1 |
| α-helix | 360-366 | 7 | |
| α-helix | 370-374 | 5 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 0-2 | 3 | |
| α-helix | 6-10 | 5 | |
| β-strand | 16-23 | 8 | 6 |
| β-strand | 26-29 | 4 | 6 |
| α-helix | 30-31 | 2 | |
| α-helix | 32-34 | 3 | |
| β-strand | 37-39 | 3 | 7 |
| β-strand | 43-51 | 9 | 6 |
| β-strand | 57-65 | 9 | 6 |
| α-helix | 71-87 | 17 | |
| β-strand | 92-98 | 7 | 6 |
| α-helix | 104-108 | 5 | |
| β-strand | 115-117 | 3 | 7 |
| α-helix | 121-123 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Actin-2 | A | protein | 378 | Plasmodium berghei (strain Anka) | Q4YU79 (AlphaFold model) |
| Gelsolin | G | protein | 127 | Mus musculus | P13020 (AlphaFold model) |
>6I4M_1 Actin-2 (chains A) GPMPEESIALVVDNGSGMVKSGLAGDDAPKCVFPSIIGIPKMPNIMVGMEQKECYVGDEA QNKRGILTLKYPIEHGIVTNWDDMEKIWRHTFFNELRVSPEEHPVLLTEAPLNPKTNREK MTQIMFESFDVPAMYVSIQAILSLYASGRTTGIVLDSGDGVTHTVPIYEGYVLPHAINRT DMAGRDLTYYMMKLFTERGYTFTTTAEREIVRDIKEKLCYIALDYDEELKKSEERTEEVE EMYELPDGNLITVGSERFRCPEALFNPSLIGRECPGLHITAYQSIMKCDIDIRKELYNNI VLSGGTTMYNYIGERLTNEMTSLAPPSMKIKVIAPPERKYSVWIGGSILSSLSTFQKMWI TKEEYDESGPSIVHRKCF
>6I4M_2 Gelsolin (chains G) GPMVVEHPEFLKAGKEPGLQIWRVEKFDLVPVPPNLYGDFFTGDAYVILKTVQLANGNLQ YDLHYWLGNECSQDESGAAAIFTVQLDDYLNGRAVQHREVQGFESSTFSGYFKSGLKYKK GGVASGF
| ID | Name | Formula | Copies |
|---|---|---|---|
| ADP | Adenosine-5'-diphosphate | C10 H15 N5 O10 P2 | 1 |
| MG | Magnesium ion | Mg | 1 |
| SCN | Thiocyanate ion | C N S | 2 |
| CA | Calcium ion | Ca | 2 |
Atomic view into Plasmodium actin polymerization, ATP hydrolysis, and fragmentation. Kumpula, E.P., Lopez, A.J., Tajedin, L. et al. PLoS Biol (2019) 17:e3000315-e3000315. DOI 10.1371/journal.pbio.3000315 · PubMed
Other PDB entries of the same protein (UniProt Q4YU79 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6I4M directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.