4CC2: Dynamin-binding protein

Complex of human Tuba C-terminal SH3 domain with human N-WASP proline- rich peptide - P212121. Determined by X-ray diffraction at 1.55 Å resolution. Released 30 Oct 2013.

Method: X-ray diffraction
Resolution: 1.55 Å
Organism: HOMO SAPIENS
Chains: 4
Atoms: 1,427
Mol. weight: 18.23 kDa
Released: 30 Oct 2013

Explore 4CC2 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4CC2 contains 5 α-helices and 18 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 9 β-strands

Element	Residues	Length	Sheet
β-strand	1517-1520	4	1
β-strand	1524	1	2
β-strand	1531	1	3
β-strand	1534	1	2
β-strand	1539-1540	2	1
β-strand	1541-1544	4	3
β-strand	1554-1559	6	3
β-strand	1562-1567	6	3
α-helix	1568-1570	3
β-strand	1571-1574	4	1

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	3-7	5

Chain C: 2 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	1516-1517	2
β-strand	1518-1520	3	4
β-strand	1524	1	5
β-strand	1531	1	6
β-strand	1534	1	5
β-strand	1539-1540	2	4
β-strand	1541-1544	4	6
β-strand	1554-1559	6	6
β-strand	1562-1567	6	6
α-helix	1568-1570	3
β-strand	1571-1572	2	4

Chain D: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	5-7	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Dynamin-binding protein	A, C	protein	67	HOMO SAPIENS	Q6XZF7 (AlphaFold model)
Neural wiskott-aldrich syndrome protein	B, D	protein	12	HOMO SAPIENS	O00401 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>4CC2_1 DYNAMIN-BINDING PROTEIN (chains A, C)
GPEGNQVYFAVYTFKARNPNELSVSANQKLKILEFKDVTGNTEWWLAEVNGKKGYVPSNY
IRKTEYT

Sequence of entity 2 (B, D), FASTA

>4CC2_2 NEURAL WISKOTT-ALDRICH SYNDROME PROTEIN (chains B, D)
PPPALPSSAPSG

Primary citation

Structural Details of Human Tuba Recruitment by Inlc of Listeria Monocytogenes Elucidate Bacterial Cell-Cell Spreading. Polle, L., Rigano, L.A., Julian, R. et al. Structure (2014) 22:304. DOI 10.1016/J.STR.2013.10.017 · PubMed

Other PDB entries of the same protein (UniProt Q6XZF7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4GLM 1.9 Å, Crystal structure of the SH3 Domain of DNMBP protein [Homo sapiens]
4CC3 1.97 Å, Complex of human Tuba C-terminal SH3 domain and Mena proline-rich peptide - H3
4CC7 1.97 Å, Crystal structure of the sixth or C-terminal SH3 domain of human Tuba in complex with…
4CC4 2.6 Å, Complex of InlC of Listeria monocytogenes and human Tuba C-terminal SH3 domain
1UG1 SH3 domain of Hypothetical protein BAA76854.1
1UHC Solution Structure of RSGI RUH-002, a SH3 Domain of KIAA1010 protein [Homo sapiens]

Browse structure collections

About this viewer

MolViewer shows 4CC2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.