4CO7: Human GATE-16

Crystal structure of human GATE-16. Determined by X-ray diffraction at 2.0 Å resolution. Released 14 Jan 2015.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: HOMO SAPIENS
Chains: 2
Atoms: 2,073
Mol. weight: 27.66 kDa
Released: 14 Jan 2015

Explore 4CO7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4CO7 contains 16 α-helices and 16 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	4-8	5
α-helix	11-24	14
β-strand	28-35	8	1
α-helix	36	1
α-helix	42-44	3
β-strand	48-52	5	1
β-strand	56	1	2
α-helix	57-67	11
β-strand	77-79	3	1
β-strand	80	1	3
β-strand	83	1	3
α-helix	84-86	3
β-strand	90	1	2
α-helix	91-98	8
α-helix	104	1
β-strand	105-110	6	1

Chain B: 8 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	4-8	5
α-helix	11-24	14
β-strand	28-35	8	4
α-helix	36	1
α-helix	42-43	2
β-strand	48-52	5	4
β-strand	56	1	5
α-helix	57-67	11
β-strand	77-79	3	4
β-strand	80	1	6
β-strand	83	1	6
α-helix	84-86	3
β-strand	90	1	5
α-helix	91-98	8
α-helix	104	1
β-strand	105-110	6	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Gamma-aminobutyric acid receptor-associated protein-like 2	A, B	protein	119	HOMO SAPIENS	P60520 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4CO7_1 GAMMA-AMINOBUTYRIC ACID RECEPTOR-ASSOCIATED PROTEIN-LIKE 2 (chains A, B)
GSMKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVA
QFMWIIRKRIQLPSEKAIFLFVDKTVPQSSLTMGQLYEKEKDEDGFLYVAYSGENTFGF

Primary citation

Conformational Polymorphism in Autophagy-Related Protein Gate-16. Ma, P., Schillinger, O., Schwarten, M. et al. Biochemistry (2015) 54:5469. DOI 10.1021/ACS.BIOCHEM.5B00366 · PubMed

Other PDB entries of the same protein (UniProt P60520 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8Q6Q 1.8 Å, Structure of human immunity related GTPase Q in complex with GABARAPL2.
7YO8 1.8 Å, Crystal structure of fission yeast Hfl1 LIR fused to human GABARAPL2
7LK3 1.9 Å, Crystal structure of untwinned human GABARAPL2
6H8C Structure of the human GABARAPL2 protein in complex with the UBA5 LIR motif

Browse structure collections

About this viewer

MolViewer shows 4CO7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.