Rsk2 C-terminal Kinase Domain, (E)-tert-butyl 3-(4-amino-7-(3-hydroxypropyl)-5-p-tolyl-7H-pyrrolo[2,3-d]pyrimidin-6-yl)-2-cyanoacrylate. Determined by X-ray diffraction at 2.4 Å resolution. Released 11 Apr 2012.
Explore 4D9U in 3D Show helices and sheets RCSB PDB PDBe
4D9U contains 18 α-helices and 15 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 412-414 | 3 | |
| α-helix | 418-421 | 4 | |
| β-strand | 422-430 | 9 | 1 |
| β-strand | 434-441 | 8 | 1 |
| β-strand | 446-454 | 9 | 1 |
| α-helix | 461-470 | 10 | |
| β-strand | 476 | 1 | 2 |
| β-strand | 479-484 | 6 | 1 |
| β-strand | 488-494 | 7 | 1 |
| α-helix | 495-496 | 2 | |
| β-strand | 500 | 1 | 2 |
| α-helix | 501-506 | 6 | |
| β-strand | 512 | 1 | 3 |
| α-helix | 513-532 | 20 | |
| β-strand | 535-536 | 2 | 4 |
| α-helix | 542-544 | 3 | |
| β-strand | 545-547 | 3 | 2 |
| α-helix | 554-556 | 3 | |
| β-strand | 557-559 | 3 | 2 |
| β-strand | 566-567 | 2 | 4 |
| β-strand | 569 | 1 | 5 |
| β-strand | 575 | 1 | 5 |
| α-helix | 589-613 | 25 | |
| α-helix | 626-635 | 10 | |
| α-helix | 643-645 | 3 | |
| α-helix | 650-660 | 11 | |
| α-helix | 668-669 | 2 | |
| α-helix | 670-673 | 4 | |
| α-helix | 677-680 | 4 | |
| α-helix | 682-684 | 3 | |
| β-strand | 689 | 1 | 3 |
| α-helix | 690 | 1 | |
| α-helix | 696-710 | 15 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Ribosomal protein S6 kinase alpha-3 | A | protein | 342 | Homo sapiens | P51812 (AlphaFold model) |
>4D9U_1 Ribosomal protein S6 kinase alpha-3 (chains A) MQTVGVHSIVQQLHRNSIQFTDGYEVKEDIGVGSYSVCKRCIHKATNMEFAVKIIDKSKR DPTEEIEILLRYGQHPNIITLKDVYDDGKYVYVVTELMKGGELLDKILRQKFFSEREASA VLFTITKTVEYLHAQGVVHRDLKPSNILYVDESGNPESIRICDFGFAKQLRAENGLLMTP CYTANFVAPEVLERQGYDAACDIWSLGVLLYTMLTGYTPFANGPDDTPEEILARIGSGKF SLSGGYWNSVSDTAKDLVSKMLHVDPHQRLTAALVLRHPWIVHWDQLPQYQLNRQDAPHL VKGAMAATYSALNRNQSPVLEPVGRSTLAQRRGIKKITSTAL
| ID | Name | Formula | Copies |
|---|---|---|---|
| 0JH | tert-butyl (2S)-3-[4-amino-7-(3-hydroxypropyl)-5-(4-methylphenyl)-7H-pyrrolo[2,… | C24 H29 N5 O3 | 1 |
Water and common crystallization additives (NA) are not listed.
Reversible targeting of noncatalytic cysteines with chemically tuned electrophiles. Serafimova, I.M., Pufall, M.A., Krishnan, S. et al. Nat Chem Biol (2012) 8:471-476. DOI 10.1038/nchembio.925 · PubMed
Other PDB entries of the same protein (UniProt P51812 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4D9U directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.