4DBQ: Myosin-VI

MYOSIN VI D179Y (MD-INSERT2-CAM, DELTA-INSERT1) post-rigor state. Determined by X-ray diffraction at 2.6 Å resolution. Released 30 Jan 2013.

Method: X-ray diffraction
Resolution: 2.6 Å
Organisms: Sus scrofa, Drosophila melanogaster
Chains: 2
Atoms: 7,584
Mol. weight: 107.74 kDa
Ligands: CA, MG, BEF, ADP
Released: 30 Jan 2013

Explore 4DBQ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4DBQ contains 48 α-helices and 31 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 40 helices, 27 β-strands

Element	Residues	Length	Sheet
β-strand	7-11	5	1
β-strand	15-24	10	1
β-strand	28-33	6	1
β-strand	41-44	4	1
α-helix	45-47	3
β-strand	49-50	2	1
β-strand	61	1	2
α-helix	62-64	3
α-helix	70-82	13
β-strand	87-90	4	2
β-strand	93-97	5	2
α-helix	109-113	5
α-helix	118-119	2
α-helix	127-141	15
β-strand	145-150	6	2
α-helix	157-172	16
α-helix	178-183	6
α-helix	185-193	9
β-strand	194-195	2	3
β-strand	203-204	2	3
β-strand	207-214	8	2
β-strand	220-228	9	2
α-helix	233-235	3
β-strand	245	1	3
α-helix	246-252	7
α-helix	259-262	4
α-helix	268-270	3
α-helix	272-275	4
α-helix	313-327	15
α-helix	331-347	17
α-helix	366-378	13
α-helix	383-391	9
β-strand	392	1	4
β-strand	410	1	4
α-helix	413-440	28
β-strand	450-456	7	2
β-strand	466	1	5
α-helix	468-499	32
α-helix	508-510	3
α-helix	512-519	8
α-helix	525-534	10
α-helix	540-550	11
β-strand	557-558	2	5
α-helix	560-562	3
α-helix	566-569	4
α-helix	573-575	3
β-strand	576-581	6	5
β-strand	584-589	6	5
α-helix	593-596	4
β-strand	598	1	6
α-helix	600-602	3
α-helix	603-610	8
α-helix	615-619	5
β-strand	642	1	6
α-helix	643-658	16
β-strand	662-669	8	2
α-helix	682-691	10
α-helix	694-702	9
β-strand	707-710	4	7
α-helix	711-718	8
α-helix	719-721	3
α-helix	731-742	12
β-strand	749-751	3	7
β-strand	755-758	4	7
α-helix	762-771	10
α-helix	774-782	9
α-helix	785-812	28

Chain B: 8 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	6-19	14
β-strand	26-27	2	8
α-helix	29-38	10
α-helix	45-53	9
β-strand	63-64	2	8
α-helix	65-71	7
α-helix	78-92	15
β-strand	100	1	9
α-helix	102-111	10
α-helix	118-128	11
β-strand	136	1	9
α-helix	138-145	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Myosin-VI	A	protein	788	Sus scrofa	Q29122 (AlphaFold model)
Calmodulin	B	protein	149	Drosophila melanogaster	P62152 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4DBQ_1 Myosin-VI (chains A)
EDGKPVWAPHPTDGFQVGNIVDIGPDSLTIEPLNQKGKTFLALINQVFPAEEDSKKDVED
NCSLMYLNEATLLHNIKVRYSKDRIYTYVANILIAVNPYFDIPKIYSSETIKSYQGKSLG
TMPPHVFAIADKAFRDMKVLKLSQSIIVSGESGAGKTENTKFVLRYLTESYGTGQDIYDR
IVEANPLLEAFGNAKTVRNNNSSRFGKFVEIHFNEKSSVVGGFVSHYLLEKSRICVQGKE
ERNYHIFYRLCAGASEDIRERLHLSSPDNFRYLNRGGSLKDPLLDDHGDFIRMCTAMKKI
GLDDEEKLDLFRVVAGVLHLGNIDFEEAGSTSGGCNLKNKSTQALEYCAELLGLDQDDLR
VSLTTRVMLTTAGGAKGTVIKVPLKVEQANNARDALAKTVYSHLFDHVVNRVNQCFPFET
SSYFIGVLDIAGFEYFEHNSFEQFCINYCNEKLQQFFNERILKEEQELYQKEGLGVNEVH
YVDNQDCIDLIEARLVGILDILDEENRLPQPSDQHFTSAVHQKHKDHFRLSIPRKSKLAI
HRNIRDDEGFIIRHFAGAVCYETTQFVEKNNDALHMSLESLICESRDKFIRELFESSTNN
NKDTKQKAGKLSFISVGNKFKTQLNLLLDKLRSTGASFIRCIKPNLKMTSHHFEGAQILS
QLQCSGMVSVLDLMQGGFPSRASFHELYNMYKKYMPDKLARLDPRLFCKALFKALGLNEI
DYKFGLTKVFFRPGKFAEFDQIMKSDPDHLAELVKRVNHWLICSRWKKVQWCSLSVIKLK
NKIKYRAE

Sequence of entity 2 (B), FASTA

>4DBQ_2 Calmodulin (chains B)
MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG
NGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDE
EVDEMIREADIDGDGQVNYEEFVTMMTSK

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	4
MG	Magnesium ion	Mg	1
BEF	Beryllium trifluoride ion	Be F3	1
ADP	Adenosine-5'-diphosphate	C10 H15 N5 O10 P2	1

Water and common crystallization additives (SO4) are not listed.

Primary citation

Mutations in myosin VI that cause a loss of coordination between heads provide insights into the structural changes underlying force generation and the importance of gating. Song, L., Pylypenko, O., Yang, Z. et al. To be published.

Other PDB entries of the same protein (UniProt Q29122 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2V26 1.75 Å, Myosin VI (MD) pre-powerstroke state (Mg.ADP.VO4)
4DBR 1.95 Å, Myosin VI D179Y (MD) pre-powerstroke state
2X51 2.2 Å, M6 delta Insert1
3L9I 2.2 Å, Myosin VI nucleotide-free (mdinsert2) L310G mutant crystal structure
4DBP 2.2 Å, Myosin VI nucleotide-free (MDINSERT2) D179Y crystal structure
5O2L 2.2 Å, Myosin VI motor domain in the Pre-Transition State
2VB6 2.3 Å, Myosin VI (MD-insert2-CaM, Delta Insert1) Post-rigor state (crystal form 2)
2BKH 2.4 Å, Myosin VI nucleotide-free (MDInsert2) crystal structure
2VAS 2.4 Å, Myosin VI (MD-insert2-CaM, Delta-Insert1) Post-rigor state
4ANJ 2.6 Å, MYOSIN VI (MDinsert2-GFP fusion) PRE-POWERSTROKE STATE (MG.ADP.AlF4)
3GN4 2.7 Å, Myosin lever arm
2BKI 2.9 Å, Myosin VI nucleotide-free (MDinsert2-IQ) crystal structure

Browse structure collections

About this viewer

MolViewer shows 4DBQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.