4DDP: Beclin 1 evolutionarily conserved domain(ECD)

crystal structure of Beclin 1 evolutionarily conserved domain(ECD). Determined by X-ray diffraction at 1.55 Å resolution. Released 22 Feb 2012.

Method: X-ray diffraction
Resolution: 1.55 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,705
Mol. weight: 24.46 kDa
Released: 22 Feb 2012

Explore 4DDP in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4DDP contains 6 α-helices and 13 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	250-262	13
β-strand	276-279	4	1
β-strand	282-285	4	1
β-strand	288-289	2	1
β-strand	293	1	2
β-strand	296	1	2
α-helix	300-321	22
α-helix	323-325	3
β-strand	328-331	4	3
β-strand	333	1	4
β-strand	335	1	4
β-strand	338-341	4	3
β-strand	349-350	2	3
α-helix	358-360	3
α-helix	364-384	21
β-strand	396-397	2	5
β-strand	402-404	3	5
β-strand	412-414	3	5
α-helix	422-446	25

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Beclin-1	A	protein	210	Homo sapiens	Q14457 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4DDP_1 Beclin-1 (chains A)
LELDDELKSVENQMRYAQTQLDKLKKTNVFNATFHIWHSGQFGTINNFRLGRLPSVPVEW
NEINAAWGQTVLLLHALANKMGLKFQRYRLVPYGNHSYLESLTDKSKELPLYCSGGLRFF
WDNKFDHAMVAFLDCVQQFKEEVEKGETRFCLPYRMDVEKGKIEDTGGSGGSYSIKTQFN
SEEQWTKALKFMLTNLKWGLAWVSSQFYNK

Primary citation

Crystal structure and biochemical analyses reveal Beclin 1 as a novel membrane binding protein. Huang, W., Choi, W., Hu, W. et al. Cell Res (2012). DOI 10.1038/cr.2012.24 · PubMed

Other PDB entries of the same protein (UniProt Q14457 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6HOI 1.14 Å, Structure of Beclin1 LIR motif bound to GABARAPL1
5HHE 1.46 Å, Human Beclin 1 coiled-coil domain
6HOJ 1.51 Å, Structure of Beclin1 LIR motif bound to GABARAP
6HOK 1.61 Å, Structure of Beclin1 LIR (S96E) motif bound to GABARAP
5VAU 1.75 Å, Bcl-2 complex with Beclin 1 BH3 domain
5VAY 1.8 Å, Bcl-2 complex with Beclin 1 T108D BH3 domain
5EFM 1.95 Å, Beclin 1 Flexible-helical Domian (FHD) (141-171)
5VAX 2.0 Å, Bcl-2 complex with Beclin 1 BH3 domain
4MI8 2.1 Å, Crystal structure of the complex of murine gamma-herpesvirus 68 Bcl-2 homolog M11 and a…
6DCO 2.2 Å, Bcl-xL complex with Beclin 1 BH3 domain T108D
6DCN 2.44 Å, Bcl-xL complex with Beclin 1 BH3 domain T108pThr
2P1L 2.5 Å, Structure of the Bcl-XL:Beclin 1 complex

Browse structure collections

About this viewer

MolViewer shows 4DDP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.