Crystal structure of a Cytoplasmic protein NCK2 (NCK2) from Homo sapiens at 2.20 A resolution. Determined by X-ray diffraction at 2.2 Å resolution. Released 4 Apr 2012.
Explore 4E6R in 3D Show helices and sheets RCSB PDB PDBe
4E6R contains 4 α-helices and 16 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 114-118 | 5 | 1 |
| β-strand | 122 | 1 | 2 |
| β-strand | 129 | 1 | 1 |
| β-strand | 132 | 1 | 2 |
| β-strand | 137-143 | 7 | 1 |
| β-strand | 148-153 | 6 | 1 |
| β-strand | 156-161 | 6 | 1 |
| α-helix | 162-164 | 3 | |
| β-strand | 165-167 | 3 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 114-118 | 5 | 3 |
| β-strand | 122 | 1 | 4 |
| β-strand | 129 | 1 | 3 |
| α-helix | 131 | 1 | |
| β-strand | 132 | 1 | 4 |
| α-helix | 133 | 1 | |
| β-strand | 137-143 | 7 | 3 |
| β-strand | 148-153 | 6 | 3 |
| β-strand | 156-161 | 6 | 3 |
| α-helix | 162-164 | 3 | |
| β-strand | 165-167 | 3 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Cytoplasmic protein NCK2 | A, B | protein | 58 | Homo sapiens | O43639 (AlphaFold model) |
>4E6R_1 Cytoplasmic protein NCK2 (chains A, B) XIPAFVKFAYVAEREDELSLVKGSRVTVMEKCSDGWWRGSYNGQIGWFPSNYVLEEVD
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 5 |
Water and common crystallization additives (UNL, IMD) are not listed.
Crystal structure of a Cytoplasmic protein NCK2 (NCK2) from Homo sapiens at 2.20 A resolution. Joint Center for Structural Genomics (JCSG), Partnership for T-Cell Biology (TCELL). To be published.
Other PDB entries of the same protein (UniProt O43639 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4E6R directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.