4ECB: PDB entry 4ECB

Chimeric GST Containing Inserts of Kininogen Peptides. Determined by X-ray diffraction at 2.2 Å resolution. Released 16 May 2012.

Method: X-ray diffraction
Resolution: 2.2 Å
Organisms: Schistosoma japonicum, homo sapiens
Chains: 2
Atoms: 3,494
Mol. weight: 53.29 kDa
Released: 16 May 2012

Explore 4ECB in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4ECB contains 16 α-helices and 12 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	4-8	5	1
α-helix	12-14	3
α-helix	15-23	9
β-strand	29-33	5	1
β-strand	67-69	3	1
β-strand	74-76	3	1
α-helix	78-88	11
α-helix	96-120	25
α-helix	125-147	23
β-strand	152	1	2
β-strand	155	1	2
α-helix	160-175	16
α-helix	184-195	12
α-helix	197-204	8

Chain B: 8 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	4-8	5	3
α-helix	12-14	3
α-helix	15-23	9
β-strand	29-33	5	3
β-strand	67-69	3	3
β-strand	74-76	3	3
α-helix	78-88	11
α-helix	96-119	24
α-helix	125-146	22
β-strand	152	1	4
β-strand	155	1	4
α-helix	160-175	16
α-helix	184-195	12
α-helix	197-203	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
chimeric protein between GSHKT10 and domain 5 of kininogen-1	A, B	protein	228	Schistosoma japonicum, homo sapiens	P01042 (AlphaFold model), P08515 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4ECB_1 chimeric protein between GSHKT10 and domain 5 of kininogen-1 (chains A, B)
MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGKHGHGHGKHKL
EFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIA
YSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCL
DAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPK

Primary citation

Chimeric glutathione S-transferases containing inserts of kininogen peptides: potential novel protein therapeutics. Bentley, A.A., Merkulov, S.M., Peng, Y. et al. J Biol Chem (2012) 287:22142-22150. DOI 10.1074/jbc.M112.372854 · PubMed

Other PDB entries of the same protein (UniProt P01042 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2WOK 1.7 Å, Clavulanic acid biosynthesis oligopeptide binding protein 2 complexed with bradykinin
4ASR 1.9 Å, Crystal structure of ANCE in complex with Thr6-Bradykinin
4ASQ 1.99 Å, Crystal structure of ANCE in complex with Bradykinin
4ECC 2.2 Å, Chimeric GST Containing Inserts of Kininogen Peptides
1NY2 2.3 Å, Human alpha thrombin inhibited by RPPGF and hirugen
7QOX 2.32 Å, Factor XI and Plasma Kallikrein apple domain structures reveals different kininogen…
7F6I 2.8 Å, Cryo-EM structure of human bradykinin receptor BK2R in complex Gq proteins and kallidin
5I25 2.85 Å, human recombinant coagulation FXI in complex with a peptide derived from human high…
8VJX 2.89 Å, Structure of Human Neurolysin in complex with bradykinin peptide
7F2O 2.9 Å, Cryo-EM structure of the type 2 bradykinin receptor in complex with the bradykinin and…
7F6H 2.9 Å, Cryo-EM structure of human bradykinin receptor BK2R in complex Gq proteins and bradykinin
7EIB 3.0 Å, Cryo-EM structure of the type 1 bradykinin receptor in complex with the…

Browse structure collections

About this viewer

MolViewer shows 4ECB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.