4ED5: Two N-terminal RRM domains of HuR

Crystal structure of the two N-terminal RRM domains of HuR complexed with RNA. Determined by X-ray diffraction at 2.0 Å resolution. Released 23 May 2012.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Homo sapiens
Chains: 4
Atoms: 3,220
Mol. weight: 47.27 kDa
Ligands: M2M
Released: 23 May 2012

Explore 4ED5 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4ED5 contains 17 α-helices and 20 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	21-25	5	1
α-helix	33-41	9
β-strand	46-53	8	1
β-strand	60-68	9	1
α-helix	71-81	11
β-strand	85-86	2	2
β-strand	89-90	2	2
β-strand	92-95	4	1
α-helix	96-99	4
α-helix	101-103	3
β-strand	107-111	5	3
α-helix	119-126	8
α-helix	127-129	3
β-strand	132-139	8	3
β-strand	146-154	9	3
α-helix	157-167	11
α-helix	171-172	2
α-helix	178-179	2
β-strand	180-183	4	3

Chain B: 8 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	21-25	5	4
α-helix	33-41	9
β-strand	46-53	8	4
β-strand	60-68	9	4
α-helix	71-81	11
β-strand	85-86	2	5
β-strand	89-90	2	5
β-strand	92-95	4	4
α-helix	96-99	4
β-strand	107-111	5	6
α-helix	119-126	8
α-helix	127-129	3
β-strand	132-139	8	6
β-strand	146-154	9	6
α-helix	157-167	11
α-helix	170-172	3
α-helix	178-179	2
β-strand	180-183	4	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
ELAV-like protein 1	A, B	protein	177	Homo sapiens	Q15717 (AlphaFold model)
5'-r(aupupupupupapupupup*u)-3'	C, D	RNA	11

Sequence of entity 1 (A, B), FASTA

>4ED5_1 ELAV-like protein 1 (chains A, B)
GRTNLIVNYLPQNMTQDELRSLFSSIGEVESAKLIRDKVAGHSLGYGFVNYVTAKDAERA
INTLNGLRLQSKTIKVSYARPSSEVIKDANLYISGLPRTMTQKDVEDMFSRFGRIINSRV
LVDQTTGLSRGVAFIRFDKRSEAEEAITSFNGHKPPGSSEPITVKFAANLEHHHHHH

Sequence of entity 2 (C, D), FASTA

>4ED5_2 5'-R(*A*UP*UP*UP*UP*UP*AP*UP*UP*UP*U)-3' (chains C, D)
AUUUUUAUUUU

Ligands and cofactors

ID	Name	Formula	Copies
M2M	1-methoxy-2-(2-methoxyethoxy)ethane	C6 H14 O3	1

Water and common crystallization additives (EDO, GOL) are not listed.

Primary citation

The structure of the ARE-binding domains of Hu antigen R (HuR) undergoes conformational changes during RNA binding. Wang, H., Zeng, F., Liu, Q. et al. Acta Crystallogr D Biol Crystallogr (2013) 69:373-380. DOI 10.1107/S0907444912047828 · PubMed

Other PDB entries of the same protein (UniProt Q15717 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6GD3 1.35 Å, Structure of HuR RRM3 in complex with RNA (UAUUUA)
4FXV 1.9 Å, Crystal structure of an ELAV-like protein 1 (ELAVL1) from Homo sapiens at 1.90 A…
6GC5 1.9 Å, Molecular basis for AU-rich element recognition and dimerization by the HuR C-terminal RRM
6GD2 1.9 Å, Structure of HuR RRM3 in complex with RNA
3HI9 2.0 Å, The x-ray crystal structure of the first RNA recognition motif (RRM1) of the AU-rich…
6G2K 2.01 Å, Structure of HuR RRM3 in complex with RNA (UUUUUU)
6GD1 2.01 Å, Structure of HuR RRM3
4EGL 2.9 Å, Crystal structure of two tandem RNA recognition motifs of Human antigen R
9W2F 3.4 Å, Cryo-EM structure of DDB1-CRBN in complex with dHuR-2 and HuR
5SZW NMR solution structure of the RRM1 domain of the post-transcriptional regulator HuR

Browse structure collections

About this viewer

MolViewer shows 4ED5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.