Crystal structure of Staphylococcal nuclease variant Delta+PHS I72D at cryogenic temperature. Determined by X-ray diffraction at 1.35 Å resolution. Released 2 May 2012.
Explore 4EQP in 3D Show helices and sheets RCSB PDB PDBe
4EQP contains 5 α-helices and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 9-17 | 9 | 1 |
| β-strand | 22-27 | 6 | 1 |
| β-strand | 30-36 | 7 | 1 |
| β-strand | 39-40 | 2 | 2 |
| α-helix | 41-43 | 3 | |
| α-helix | 55-68 | 14 | |
| β-strand | 72-75 | 4 | 1 |
| β-strand | 82 | 1 | 1 |
| β-strand | 88-94 | 7 | 1 |
| β-strand | 97-98 | 2 | 1 |
| α-helix | 99-105 | 7 | |
| β-strand | 110-111 | 2 | 2 |
| α-helix | 122-134 | 13 | |
| α-helix | 138-140 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Thermonuclease | A | protein | 143 | Staphylococcus aureus | P00644 (AlphaFold model) |
>4EQP_1 Thermonuclease (chains A) ATSTKKLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMV ENAKKDEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLR KAEAQAKKEKLNIWSEDNADSGQ
Crystal structure of Staphylococcal nuclease variant Delta+PHS I72D at cryogenic temperature. Robinson, A.C., Schlessman, J.L., Heroux, A. et al. To be published.
Other PDB entries of the same protein (UniProt P00644 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4EQP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.