4F11: PDB entry 4F11

Crystal structure of the extracellular domain of human GABA(B) receptor GBR2. Determined by X-ray diffraction at 2.38 Å resolution. Released 6 Jun 2012.

Method: X-ray diffraction
Resolution: 2.38 Å
Organism: Homo sapiens
Chains: 1
Atoms: 3,478
Mol. weight: 49.13 kDa
Released: 6 Jun 2012

Explore 4F11 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4F11 contains 20 α-helices and 16 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 20 helices, 16 β-strands

Element	Residues	Length	Sheet
α-helix	53-54	2
β-strand	55-62	8	1
α-helix	71-90	20
β-strand	98-105	8	1
α-helix	110-123	14
β-strand	129-132	4	1
α-helix	136-144	9
α-helix	146-149	4
β-strand	152-155	4	1
α-helix	161-164	4
β-strand	172-174	3	1
α-helix	177-178	2
α-helix	179-181	3
α-helix	182-192	11
β-strand	197-203	7	2
α-helix	206-218	13
β-strand	225-232	8	2
α-helix	237-245	9
β-strand	250-254	5	2
α-helix	257-269	13
β-strand	278-282	5	2
α-helix	304-311	8
β-strand	315-319	5	2
α-helix	335-346	12
α-helix	355-378	24
α-helix	385-387	3
α-helix	393-404	12
β-strand	407-410	4	3
β-strand	413-418	6	3
β-strand	421-423	3	3
β-strand	425-432	8	2
β-strand	435-443	9	2
β-strand	448-451	4	2
α-helix	452	1
α-helix	463-465	3
α-helix	468-473	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Gamma-aminobutyric acid type B receptor subunit 2	A	protein	433	Homo sapiens	O75899 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4F11_1 Gamma-aminobutyric acid type B receptor subunit 2 (chains A)
WARGAPRPPPSSPPLSIMGLMPLTKEVAKGSIGRGVLPAVELAIEQIRNESLLRPYFLDL
RLYDTECDNAKGLKAFYDAIKYGPNHLMVFGGVCPSVTSIIAESLQGWNLVQLSFAATTP
VLADKKKYPYFFRTVPSDNAVNPAILKLLKHYQWKRVGTLTQDVQRFSEVRNDLTGVLYG
EDIEISDTESFSNDPCTSVKKLKGNDVRIILGQFDQNMAAKVFCCAYEENMYGSKYQWII
PGWYEPSWWEQVHTEANSSRCLRKNLLAAMEGYIGVDFEPLSSKQIKTISGKTPQQYERE
YNNKRSGVGPSKFHGYAYDGIWVIAKTLQRAMETLHASSRHQRIQDFNYTDHTLGRIILN
AMNETNFFGVTGQVVFRNGERMGTIKFTQFQDSREVKVGEYNAVADTLEIINDTIRFQGS
EPPKDDYKDDDDK

Primary citation

Structure and functional interaction of the extracellular domain of human GABA(B) receptor GBR2. Geng, Y., Xiong, D., Mosyak, L. et al. Nat Neurosci (2012) 15:970-978. DOI 10.1038/nn.3133 · PubMed

Other PDB entries of the same protein (UniProt O75899 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4PAS 1.62 Å, Heterodimeric coiled-coil structure of human GABA(B) receptor
4MS4 1.9 Å, Crystal structure of the extracellular domain of human GABA(B) receptor bound to the…
4MR7 2.15 Å, Crystal structure of the extracellular domain of human GABA(B) receptor bound to the…
4MR8 2.15 Å, Crystal structure of the extracellular domain of human GABA(B) receptor bound to the…
4MQF 2.22 Å, Crystal structure of the extracellular domain of human GABA(B) receptor bound to the…
4MS1 2.25 Å, Crystal structure of the extracellular domain of human GABA(B) receptor bound to the…
4MQE 2.35 Å, Crystal structure of the extracellular domain of human GABA(B) receptor in the apo form
4MR9 2.35 Å, Crystal structure of the extracellular domain of human GABA(B) receptor bound to the…
6OCP 2.35 Å, Crystal structure of a human GABAB receptor peptide bound to KCTD16 T1
4MS3 2.5 Å, Crystal structure of the extracellular domain of human GABA(B) receptor bound to the…
4MRM 2.86 Å, Crystal structure of the extracellular domain of human GABA(B) receptor bound to the…
7C7S 2.9 Å, Cryo-EM structure of the CGP54626-bound human GABA(B) receptor in inactive state.

Browse structure collections

About this viewer

MolViewer shows 4F11 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.