Atomic structures of the rapamycin analogs in complex with both human FKBP12 and frb domain of frap. Determined by X-ray diffraction at 2.8 Å resolution. Released 13 Sept 2000.
Explore 4FAP in 3D Show helices and sheets RCSB PDB PDBe
4FAP contains 8 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2-8 | 7 | 1 |
| β-strand | 21-30 | 10 | 1 |
| β-strand | 35-38 | 4 | 1 |
| α-helix | 39-42 | 4 | |
| β-strand | 46-49 | 4 | 1 |
| α-helix | 57-64 | 8 | |
| β-strand | 71-76 | 6 | 1 |
| α-helix | 78-80 | 3 | |
| β-strand | 87 | 1 | 2 |
| β-strand | 91 | 1 | 2 |
| β-strand | 97-106 | 10 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 112-124 | 13 | |
| α-helix | 125-129 | 5 | |
| α-helix | 133-148 | 16 | |
| α-helix | 154-180 | 27 | |
| α-helix | 183-200 | 18 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| FK506-binding protein | A | protein | 107 | Homo sapiens | P62942 (AlphaFold model) |
| FKBP12-rapamycin associated protein | B | protein | 94 | Homo sapiens | P42345 (AlphaFold model) |
>4FAP_1 FK506-BINDING PROTEIN (chains A) GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWE EGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
>4FAP_2 FKBP12-RAPAMYCIN ASSOCIATED PROTEIN (chains B) VAILWHEMWHEGLEEASRLYFGERNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDL MEAQEWCRKYMKSGNVKDLTQAWDLYYHVFRRIS
| ID | Name | Formula | Copies |
|---|---|---|---|
| ARD | C15-(R)-methylthienyl rapamycin | C55 H81 N O12 S | 1 |
Refined structure of the FKBP12-rapamycin-FRB ternary complex at 2.2 A resolution. Liang, J., Choi, J., Clardy, J. Acta Crystallogr D Biol Crystallogr (1999) 55:736-744. DOI 10.1107/S0907444998014747 · PubMed
Other PDB entries of the same protein (UniProt P62942 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4FAP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.