4FLA: Human RPRD1B, carboxy-terminal domain

Crystal structure of human RPRD1B, carboxy-terminal domain. Determined by X-ray diffraction at 2.2 Å resolution. Released 22 Aug 2012.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: Homo sapiens
Chains: 4
Atoms: 4,100
Mol. weight: 69.46 kDa
Released: 22 Aug 2012

Explore 4FLA in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4FLA contains 21 α-helices and 0 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	177-202	26
α-helix	206-208	3
α-helix	211-216	6
α-helix	220-298	79

Chain B: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	177-189	13
α-helix	194-202	9
α-helix	206-208	3
α-helix	211-216	6
α-helix	220-296	77
α-helix	297-299	3

Chain C: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	176-202	27
α-helix	206-208	3
α-helix	211-216	6
α-helix	220-296	77
α-helix	297-299	3

Chain D: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	176-189	14
α-helix	191-202	12
α-helix	206-208	3
α-helix	211-216	6
α-helix	220-296	77
α-helix	297-299	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Regulation of nuclear pre-mRNA domain-containing protein 1B	A, B, C, D	protein	152	Homo sapiens	Q9NQG5 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>4FLA_1 Regulation of nuclear pre-mRNA domain-containing protein 1B (chains A, B, C, D)
MHHHHHHSSGRENLYFQGAGPLLTEELIKALQDLENAASGDATVRQKIASLPQEVQDVSL
LEKITDKEAAERLSKTVDEACLLLAEYNGRLAAELEDRRQLARMLVEYTQNQKDVLSEKE
KKLEEYKQKLARVTQVRKELKSHIQSLPDLSL

Primary citation

RPRD1A and RPRD1B are human RNA polymerase II C-terminal domain scaffolds for Ser5 dephosphorylation. Ni, Z., Xu, C., Guo, X. et al. Nat Struct Mol Biol (2014) 21:686-695. DOI 10.1038/nsmb.2853 · PubMed

Other PDB entries of the same protein (UniProt Q9NQG5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4Q94 1.85 Å, human RPRD1B CID in complex with a RPB1-CTD derived Ser2 phosphorylated peptide
4Q96 1.85 Å, CID of human RPRD1B in complex with an unmodified CTD peptide
4FU3 1.9 Å, CID of human RPRD1B
4HFG 2.0 Å, CID of human RPRD1B
9B9L 2.5 Å, RPRD1B C-terminal interacting domain bound to a pThr4 CTD peptide
4NAD 2.8 Å, Crystal Structure of the C-terminal Domain of CREPT

Browse structure collections

About this viewer

MolViewer shows 4FLA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.