4NAD: C-terminal Domain of CREPT

Crystal Structure of the C-terminal Domain of CREPT. Determined by X-ray diffraction at 2.8 Å resolution. Released 11 Dec 2013.

Method: X-ray diffraction
Resolution: 2.8 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,104
Mol. weight: 34.17 kDa
Released: 11 Dec 2013

Explore 4NAD in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4NAD contains 12 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	177-185	9
α-helix	188-190	3
α-helix	194-202	9
α-helix	206-208	3
α-helix	211-216	6
α-helix	220-297	78

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Regulation of nuclear pre-mRNA domain-containing protein 1B	A, B	protein	154	Homo sapiens	Q9NQG5 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4NAD_1 Regulation of nuclear pre-mRNA domain-containing protein 1B (chains A, B)
AMGSTEELIKALQDLENAASGDATVRQKIASLPQEVQDVSLLEKITDKEAAERLSKTVDE
ACLLLAEYNGRLAAELEDRRQLARMLVEYTQNQKDVLSEKEKKLEEYKQKLARVTQVRKE
LKSHIQSLPDLSLLPNVTGGLAPLPSAGDLFSTD

Primary citation

Crystal Structure of the C-terminal Domain of CREPT. Mei, K., Jin, Z., Ren, F. et al. To be published.

Other PDB entries of the same protein (UniProt Q9NQG5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4Q94 1.85 Å, human RPRD1B CID in complex with a RPB1-CTD derived Ser2 phosphorylated peptide
4Q96 1.85 Å, CID of human RPRD1B in complex with an unmodified CTD peptide
4FU3 1.9 Å, CID of human RPRD1B
4HFG 2.0 Å, CID of human RPRD1B
4FLA 2.2 Å, Crystal structure of human RPRD1B, carboxy-terminal domain
9B9L 2.5 Å, RPRD1B C-terminal interacting domain bound to a pThr4 CTD peptide

Browse structure collections

About this viewer

MolViewer shows 4NAD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.